KEGG   Frischella perrara: FPB0191_00069Help
Entry
FPB0191_00069     CDS       T03525                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
fpp  Frischella perrara
Pathway
fpp00061  Fatty acid biosynthesis
fpp00780  Biotin metabolism
fpp01100  Metabolic pathways
fpp01212  Fatty acid metabolism
Module
fpp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:fpp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FPB0191_00069
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FPB0191_00069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fpp01004]
    FPB0191_00069
Enzymes [BR:fpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     FPB0191_00069
Lipid biosynthesis proteins [BR:fpp01004]
 Fatty acid synthase
  Component type
   FPB0191_00069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: AJA43937
UniProt: A0A0A7RZD3
LinkDB All DBs
Position
complement(81503..81949)
Genome map
AA seq 148 aa AA seqDB search
MSTELNSLDIEEIIRLLPHRFPFLMVDRVVSYEKGKTLRAIKNVSVNEPFFQGHFPNKPV
FPGVLILEAMAQATGILAFKSIQELTPGQLYYFASIDKARFKRPVIPGDQMILDVTYVKE
RRGIALFHGVATVDGQLVCEAEMMCARK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaccgaactaaattctctcgatattgaagaaattatacgtctattacctcatcgc
ttcccattcctaatggttgatcgcgtagtaagttatgaaaaaggtaaaacacttcgcgca
attaaaaatgtatccgttaatgaaccttttttccaaggtcatttcccgaataaacctgtt
ttccctggtgttttgattttagaggcaatggctcaagcaaccggtattttagcgtttaag
agtattcaagaacttacacctggacaactatattatttcgcgtcaattgataaagctcgt
tttaaacgccctgtaatacccggcgatcaaatgattctggatgtaacttatgtaaaagaa
cgccgtggtattgcattatttcatggtgttgctactgtcgatggtcagctagtgtgtgaa
gctgaaatgatgtgtgcacgtaaatag

DBGET integrated database retrieval system