KEGG   Flavobacterium psychrophilum 950106-1/1: IB65_04945Help
Entry
IB65_04945        CDS       T03412                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fpq  Flavobacterium psychrophilum 950106-1/1
Pathway
fpq00473  D-Alanine metabolism
fpq01100  Metabolic pathways
fpq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fpq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IB65_04945
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    IB65_04945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fpq01011]
    IB65_04945
Enzymes [BR:fpq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IB65_04945
Peptidoglycan biosynthesis and degradation proteins [BR:fpq01011]
 Precursor biosynthesis
  Racemase
   IB65_04945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AIT65246
UniProt: A0A075S5G8
LinkDB All DBs
Position
1094527..1096971
Genome map
AA seq 814 aa AA seqDB search
MTISLHNIIPILDANFQGIDENIYYDTISIDSRSLQNNENTLFFALVGPNNDAHIYIGDL
ISKGVKNFVVTYIPKRLTGKANFLIVKNTLVALQIFARYYRNLFHFPIIGITGSNGKTIV
KEWLNFLLSPDYNIIRSPKSYNSQVGVPLSVIAINENHNLGIFEAGISTKDEMENLQKII
QPTIGILTNIGTAHDEGFADISEKIKEKLKLFTAVEVLILNKNKTIETFINKEINTFTWS
TNDQSADVFFQKKTLNDHALLNITNQGKYFKIKIPFIDEASLENSMHCILVMLYLKYDLD
TIKHRISQLFPVEMRLKVKNGINNCTLIDDSYSSDFQSLKIALDFLENQKQHLKKTLILS
DIYQSGLENEDLYVRVSQLIISNKINRVICIGGVISKYKNKFLNVISYLSTNDFIEDFDN
LDFTNETILIKGSRHFEFEKIVTLLEEKTHETVLEINLNAISHNLNYFKSKLNPKTKIMV
MVKAFGYGSGSFEIAKLLAHHKVNYLGVAFADEGIELRQAGIQLPIMVLNPEMTSFPSII
QYNLEPEIYSIRGLKAFIKITQQKELTSYPIHIKINTGMNRLGFDAQIIPELISILQKHD
SVLVKSILSHLAASDDLAQDIFTRKQISDFDTISNKITTKLKINPIRHISNTSAISNYPQ
AQFDMVRLGIGLYGVSNDANETKKLENVGTLKSIISQIRNLNSGQSVGYNRRFMVKKPTT
IATIPIGYADGISRAWGNEVGYVLVNEQKAPIVGSICMDMLMIDVTKINCSEGNQVIIFG
KTPSVTTIAKATKTIPYEILTSISSRVKRVFYRE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
ttgactatatccttacacaatataattcctattctagatgccaattttcagggtattgac
gaaaatatttactacgatactatctcgatagatagtcgttcgcttcaaaacaacgaaaac
actttgttttttgcactagttggtcctaataatgatgcccatatttatattggagattta
atctccaaaggtgttaaaaactttgtagttacctatattcctaaaagattaactggcaaa
gcaaattttttaattgtaaaaaacactcttgtagctttacaaatatttgcccgttattat
cgtaatttatttcattttccaatcataggaattacaggaagcaacggaaaaaccattgta
aaagaatggcttaatttcttattaagtcctgattataatataattagaagtcctaaaagc
tacaattcgcaagttggcgttcccctttctgtgattgcaattaatgaaaatcataattta
ggcatttttgaagccggaatttctaccaaagacgaaatggaaaatcttcaaaaaataata
cagccaaccattgggattttaaccaatatagggaccgctcatgatgaaggttttgctgat
atttctgagaaaataaaagaaaaactcaagctatttactgccgtagaagttttaattctt
aataagaataaaaccatcgaaacttttattaacaaagagattaatacttttacttggagt
acaaatgatcagtctgccgatgttttttttcagaaaaaaacactcaatgatcatgctctt
ttgaatattacaaatcaggggaaatattttaaaataaaaattccatttattgatgaagct
tcactagaaaacagcatgcattgcattttggtaatgttatatttgaagtatgatttagat
acaattaagcatcgtatttctcaattatttccagtcgaaatgcgattgaaggtaaaaaac
ggaattaacaattgtactttaattgatgatagttatagttctgattttcagtctttaaaa
atagctttagattttcttgaaaatcaaaaacaacacttaaaaaaaacactcattttatca
gatatttatcagtcaggattagaaaacgaagacttatatgttcgtgtttctcagcttatt
atttcaaacaaaataaatcgagtaatttgcattggaggtgtaatttctaaatataaaaac
aagtttctcaatgtcatttcttacctttcaacaaatgattttattgaagattttgacaat
ctagattttacaaacgaaactattttaataaaaggatctcgacatttcgaattcgaaaaa
attgtaaccttactcgaggaaaaaacacatgaaacagttttagaaattaaccttaatgcc
ataagccataatttaaattacttcaaatcgaaactaaatcccaaaaccaaaatcatggtt
atggtaaaagcttttggttacggaagtggctcatttgagattgccaaactcctcgcccac
cacaaagtaaattatcttggtgtggcattcgccgatgaaggaatcgaactccgccaagca
ggcattcaattacctatcatggttctaaatccagaaatgaccagtttcccatcgataatt
caatacaatttagaacccgaaatatatagtattcgaggtctgaaagcatttataaaaatt
acccaacaaaaagaacttaccagttatcctatacatattaagataaatacaggtatgaat
cgtttgggttttgatgcgcaaattattccagaactcatctcaatattacaaaagcatgat
tcagttttggtaaaaagtattttgtctcatttagcggcaagcgatgatttagcacaggat
atttttacccgaaaacaaatttcagattttgatacaatatctaataaaattaccacaaaa
ttaaaaataaaccctattcgccatatttcaaacacctctgcaataagcaattatccgcaa
gcgcagtttgatatggttcgattaggcattgggttatatggcgtttctaatgatgccaat
gaaacaaaaaaacttgaaaatgtagggacactaaaatcgataatttcacaaattcgcaat
ttaaacagtggccaaagcgtagggtataatagaaggtttatggtaaaaaaacctaccaca
attgctacaatcccaataggctatgccgacggaatttcacgtgcttggggaaatgaagtt
ggttatgttttagttaatgaacaaaaagcccccatagtaggaagtatttgtatggatatg
ctaatgatagatgtcacaaaaattaattgttctgaaggtaatcaagtaattatctttggc
aagaccccatcagtaaccaccatcgcaaaagcaacaaaaacaataccttacgaaatatta
acaagtatttcaagcagggtaaaacgggttttttacagagaataa

DBGET integrated database retrieval system