KEGG   Flavobacterium psychrophilum 950106-1/1: IB65_11745Help
Entry
IB65_11745        CDS       T03412                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fpq  Flavobacterium psychrophilum 950106-1/1
Pathway
fpq00010  Glycolysis / Gluconeogenesis
fpq00071  Fatty acid degradation
fpq00280  Valine, leucine and isoleucine degradation
fpq00310  Lysine degradation
fpq00330  Arginine and proline metabolism
fpq00340  Histidine metabolism
fpq00380  Tryptophan metabolism
fpq00410  beta-Alanine metabolism
fpq00561  Glycerolipid metabolism
fpq00620  Pyruvate metabolism
fpq00625  Chloroalkane and chloroalkene degradation
fpq01100  Metabolic pathways
fpq01110  Biosynthesis of secondary metabolites
fpq01120  Microbial metabolism in diverse environments
fpq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IB65_11745
   00053 Ascorbate and aldarate metabolism
    IB65_11745
   00620 Pyruvate metabolism
    IB65_11745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IB65_11745
   00561 Glycerolipid metabolism
    IB65_11745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IB65_11745
   00310 Lysine degradation
    IB65_11745
   00330 Arginine and proline metabolism
    IB65_11745
   00340 Histidine metabolism
    IB65_11745
   00380 Tryptophan metabolism
    IB65_11745
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IB65_11745
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    IB65_11745
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    IB65_11745
Enzymes [BR:fpq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     IB65_11745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIT66479
UniProt: A0A076P5I7
LinkDB All DBs
Position
2517921..2519474
Genome map
AA seq 517 aa AA seqDB search
MATIAEQFGMTEALAQLGIKAVNEGTSTGSQWFSNGELLESYSPVDGLLIGKVKATTAAD
YERVMQSATQAFKSFRAMPAPQRGEIVRQFGNKLRELKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQTIPSERPGHVMREQWHSIGVVGIISAFNFPVAVWAWNTAL
AWICGDVCVWKASEKAPLCSVACQNIIADILKANNLPEGISCIINGDYKVGEMMTTDVRI
PLISATGSTRMGRIVGSTVAQRFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTAG
QRCTSTRRLIIHESVYDKVRDAIVGAYGQLTIGNPLDQKNHIGPLIDKESVSTYLAAIEA
AKAEGGKVLVEGGVLQGLGYESGCYVKPAIIEAENTYKIVQHETFAPILYLMKYSGEVEN
AIEVQNGVAQGLSSAIMTNSMKEAEKFLSFSGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTVNYSDELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatagcagaacaattcggcatgaccgaagcattagcacaattaggtataaaa
gcagtaaacgaaggaacttcaacaggaagccaatggttttctaacggagaattactagaa
agctattcaccagtagatggtctattaatagggaaagtaaaagcaactaccgctgccgat
tacgaaagagtaatgcaaagcgcaacccaagcctttaaaagctttagagctatgcctgca
ccacaaagaggggaaattgttcgccaatttggaaataaattaagagaattaaaagaaccc
cttggtaagttagtttcttacgaaatgggtaaatctttgcaagaaggatatggtgaagtt
caagaaatgatagatatctgcgattttgcagtaggtttatctcgacaattaaacggacaa
acaattccttcagaacgtccaggtcatgttatgagagaacaatggcattctattggtgtc
gtaggaattatttctgcctttaattttccagtagctgtttgggcttggaacaccgcttta
gcttggatttgtggagatgtatgcgtttggaaagcttcagaaaaagcgccattgtgttct
gtggcttgccaaaacattattgccgacatattaaaagcaaataatttacccgaaggtatt
tcatgtattattaatggcgattataaagtaggcgaaatgatgactaccgatgtaagaatc
ccattaatttctgcaacaggatctactcgtatgggaagaattgttggttcgacagtagca
caacgttttggtaaatctttactagaattaggaggaaataatgccattattattacacct
actgccgatttgaaagtggttgttccaggagcagtatttggtgctgtgggaactgctgga
caaagatgtacttctacaagaagattaattattcatgaatctgtttacgataaagtaaga
gatgctatcgtgggtgcttatgggcagctaacgattggcaatcctttagatcaaaaaaat
catattggcccgttaatcgataaagaatctgtaagcacttatttagctgccattgaagct
gcaaaagcagaaggcggaaaagtattagttgaaggtggagttttacaaggtcttggttac
gaatctggttgttatgtaaaaccagccattatcgaagccgaaaatacttacaaaattgta
caacacgaaacgtttgctcctattttatatttaatgaaatatagtggtgaagttgaaaat
gcaatcgaagtacaaaacggagttgcccaaggattgtcttcggcaattatgaccaatagt
atgaaagaagcagaaaaattcttatcgttctctggttcagattgcggtattgctaatgta
aacattggaacttctggtgcagaaattgggggtgcttttggtggagaaaaagaaactggt
ggcgggcgtgagtctggctctgatgcttggaaagtttacatgagaagacaaacaaacaca
gttaactattctgacgaattacctttagcacaaggaattaaatttgacttgtag

DBGET integrated database retrieval system