KEGG   Faecalibacterium prausnitzii L2-6: FP2_18790Help
Entry
FP2_18790         CDS       T02591                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
fpr  Faecalibacterium prausnitzii L2-6
Brite
KEGG Orthology (KO) [BR:fpr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:fpr03012]
    FP2_18790
   03029 Mitochondrial biogenesis [BR:fpr03029]
    FP2_18790
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpr04147]
    FP2_18790
Translation factors [BR:fpr03012]
 Eukaryotic Type
  Elongation factors
   FP2_18790
 Prokaryotic Type
   FP2_18790
Mitochondrial biogenesis [BR:fpr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    FP2_18790
Exosome [BR:fpr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FP2_18790
  Exosomal proteins of breast cancer cells
   FP2_18790
  Exosomal proteins of colorectal cancer cells
   FP2_18790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CBK99302
UniProt: D4JZ53
LinkDB All DBs
Position
1870726..1871928
Genome map
AA seq 400 aa AA seqDB search
MAEKAKFDRSKPHVNIGTIGHVDHGKTTLTAAITKYLALKGDAEFMDYANIDKAPEERAR
GITINSAHVEYQTDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREH
ILLARQVGVPYIVVFMNKCDMVDDEELLDLVEMEIRELLSEYDFPGDDTPIIRGSALKAL
EAPNDPDDPAYECIKELMNAVDTYIPNPDREEDKPFLMPIEDVMTISGRGTVATGRVERG
VAKVGDAMEIVGIKPDRLSTTVTGLEMFRKSLDYAEAGDNIGALLRGVDRTQIERGQVLA
KPGSVHPHKVFESQVYVLTKDEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGTEMCMPG
DNVMMHVELLTPVAMEEGLRFAIREGGRTVGSGVVGKIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaggcaaagttcgaccgttctaagccgcatgttaacatcggcaccatcggt
cacgttgaccacggcaagaccactctgaccgctgctatcaccaagtacctggcactgaag
ggcgacgcagagttcatggactacgccaacatcgataaggctcctgaggagcgtgctcgt
ggtatcacgatcaactccgctcacgttgagtatcagaccgacgctcgtcactatgctcac
gttgactgcccgggccatgctgactacgtcaagaacatgatcaccggtgctgctcagatg
gacggcgctatcctggtcgttgctgctaccgatggtcccatgccccagacccgtgagcac
atcctgctggctcgtcaggtcggcgtgccctatatcgttgtcttcatgaacaagtgcgat
atggtcgacgacgaggagctgctggatctggtcgagatggagatccgtgagctgctgtcc
gagtacgacttcccgggcgacgacaccccgatcattcgtggttccgctctgaaggctctg
gaggctcccaacgatcccgatgatcccgcttacgagtgcatcaaggagctgatgaacgct
gtcgatacctatatccccaaccccgatcgtgaggaggacaagcccttcctgatgcccatc
gaggatgtcatgaccatttccggccgtggtactgttgctaccggtcgtgttgagcgtggc
gttgctaaggttggcgatgcaatggagatcgtcggcattaagcccgaccgtctgtccacc
accgtcaccggcctggagatgttccgtaagtctctggactatgctgaggctggcgataac
atcggcgctctgctgcgtggtgttgaccgcacccagatcgagcgtggccaggttctggct
aagcccggttctgtccatccccacaaggtcttcgagtcccaggtctacgttctgaccaag
gacgaaggtggccgtcacaccccgttcttctccaactatcgtcctcagttctacttccgt
accaccgacgtgaccggcatcatcaccctgccggaaggcaccgagatgtgcatgcctggc
gataacgtcatgatgcacgttgagctgctgacccctgtcgctatggaagagggcctgcgt
ttcgctatccgtgagggtggccgtaccgttggttccggcgtcgtcggcaagatcattgag
tga

DBGET integrated database retrieval system