KEGG   Flavobacterium psychrophilum JIP02/86: FP0015Help
Entry
FP0015            CDS       T00548                                 

Gene name
sprD
Definition
(RefSeq) Putative cell surface protein precursor SprD
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PorP_SprF
Motif
Other DBs
NCBI-GeneID: 5300591
NCBI-ProteinID: YP_001294955
UniProt: A6GVL2
LinkDB All DBs
Position
32566..36426
Genome map
AA seq 1286 aa AA seqDB search
MKKEFINLLLILGFILPNHAQTGGVVSFDVPAKNSLKFNKFLINPTFSFVREDESFVSMY
NKRQFSGLENAPQAYFASYSGKFREDNAIGFGLFQRNYGVLTTFGIVGNFARNVELSNNS
NFTFGLNLAYINSGLNTGKIVTGEAEPLLQTVPKNSLVTINPGLNYSTGFIDFGIAANNI
FTYNFSGSDLVSDDPAKSFVGHVMYTGYLYNNSGLFENGKFSMIVKGEAAKEKTIFSTNL
LLNAPKAGWVQAGYNSLYGISAGIGFTVAKKLSIGYTLEKGIGNLSNLGLSHEITLAYKL
KGYGDFEDYKPIVKATKKTNPGTKNATVNKKTPADLQKERAEALALKTEKDKARAEAEKV
RKAKELADAKEKAEVLAALRKAQADKLLALQGKDKAVLEAERQRKLKEAADSRANNANAA
RLKAEQDKANALAESQRLRNEKAAADAKAKTDAQRLRTEKAIADAKALADAKSQARTNAA
KALADAANAKAEAERLRKEKADADAKALSDAKAQAKAESDKLKANQAEAERLRKEKADAD
AKALADAKAQAKSEADKLKANQAEAERLRKEKADAEAKALADAKAQAKAEADKLKANQAE
AERLRKEKADADAKALADAKAQAKAEADKLKANQAEAERLRKEKADADAKALADAKAQAK
SEADKLKANQAEAERLRKEKAEAEAKALADAKVQAKAEADKLKANQAEAERLRKEKADAD
AKALADAKVQAKAEADKLKANQAEAERLRKEKADADAKALADAKVQAKAEADKLKANQAE
AERLRKEKADADAKALADAKAQAKAEADKLKANQAEAERLRKEKADADAKALADAKAQAK
AEADKLKANQAEAERLRKEKADADAKALADAKAQAKSEADKLKANQVEAERLRKEKADAD
AKALADAKAQAKSEADKLKANQAEAERLRKEKADADAKALADAKAQTKSEADKLKANQVE
AERLRKEKAEADAKALADETTERLRKEADAKAKIDEAKTTEDKELDNLSQVLEDSKKNQK
QSLSRLDSITKAKDNELKELRRVNDLSDKGIVSEAKDFQNTSAANRALESLKSEIAESSK
NQNNFIKEFETLTNERLKKVPNRNDIVNQSNLKSLEKLKLDKLNSDKQNADLLTKLETIK
AETVIEKSRRIKRAQFDSDDAKYQKDRETLKEIKTSTAPTGQTYKPTDFDFGEEQAGTQI
IKNNDNIPEGYYIVIAIHKDVAKRDAFVKKAIQAGQKDIDFFYNASNGNYYIYYDRQNQI
QEATTAMESKGSKPYNGKMVIVKVEK
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaatttataaatttattactaattttaggtttcattttacccaaccacgca
cagacaggaggtgtggtttcgtttgatgtgcctgcaaaaaactcactaaaatttaataaa
ttcttaataaatccaacttttagttttgtacgtgaagatgaatcttttgttagtatgtac
aacaaaagacaattctcaggactcgaaaacgcaccacaagcttattttgcaagttattca
ggaaaatttagagaagataacgcaataggtttcggattatttcaacgcaactacggagta
ctaactacattcggaatcgttggaaactttgccagaaatgtcgaactttctaataacagc
aattttactttcggattaaatttagcatatataaacagcgggttaaacaccggaaaaata
gttaccggagaagctgaacccttattacaaaccgtaccaaaaaattcattagttaccata
aacccaggattaaattatagtactggttttatcgattttggtatagccgcaaacaacatt
tttacctataatttttcgggttcagatttagtttcagatgaccccgcaaagagtttcgta
ggacacgttatgtacacaggttacctgtataacaattcaggactattcgaaaacggaaaa
ttttctatgatagtaaaaggagaagccgcaaaagaaaaaactatttttagcacaaactta
cttcttaatgcacccaaagccggttgggtacaagcagggtacaatagcctttacggaatt
tcagcaggaataggctttacagtagcaaaaaaattatcaataggatatacactcgaaaaa
ggaataggaaatttatcaaacctgggcttatcacacgaaatcacattagcatacaaacta
aaaggttatggcgattttgaagactataagccaatagtaaaagccactaaaaaaacaaat
ccaggaacaaaaaacgcaacggttaataaaaaaacgcctgccgatcttcaaaaagaacga
gcagaagcattagccctaaaaaccgaaaaagacaaagcaagagcagaagcagaaaaagta
agaaaagctaaagaattagccgacgccaaagaaaaagcagaagtattagcagcacttaga
aaagcgcaagccgataaattattagccttacaaggaaaagacaaagcggttctagaagca
gaaagacaaagaaaactaaaagaagctgcagattccagagcaaataacgcaaatgccgca
agacttaaagcagaacaagacaaagcaaatgcattagcagaatcacaaagattaagaaac
gaaaaagcagccgctgatgctaaagcaaaaaccgatgcccagcgtttgcgtacagaaaaa
gcaattgccgatgccaaagcgcttgccgatgccaaatcacaagcaagaacaaatgccgca
aaagcacttgcagatgccgcaaatgctaaagcggaagctgaacgtttgcgcaaagaaaaa
gccgatgccgatgccaaagcgctttctgatgccaaagcacaagcaaaagccgaatccgac
aaactaaaagccaaccaagcggaagctgaacgtttgcgcaaagaaaaagctgatgccgat
gccaaagcgcttgccgatgccaaagcacaagcaaaatccgaagccgacaaactaaaagcc
aaccaagcggaagctgaacgtttgcgcaaagaaaaagctgatgccgaagccaaagcactt
gctgatgccaaagcacaagcaaaagccgaagccgacaagctaaaagccaaccaagcggaa
gctgaacgtttgcgcaaagaaaaagctgatgccgatgccaaagcgcttgccgatgccaaa
gcacaagcaaaagccgaagccgacaagctaaaagccaaccaagcggaagctgaacgtttg
cgcaaagaaaaagctgatgccgatgccaaagcgcttgccgatgccaaagcacaagcaaaa
tccgaagccgacaaactaaaagccaaccaagcggaagctgaacgtttgcgcaaagaaaaa
gccgaagccgaagccaaagcacttgctgatgccaaagtacaagcaaaagccgaagccgac
aaactaaaagccaaccaagcggaagctgagcgtttgcgcaaagaaaaagctgatgccgat
gctaaagcacttgctgatgccaaagtacaagcaaaagccgaagccgacaaactaaaagct
aaccaagcggaagctgaacgtttgcgcaaagaaaaagccgatgccgatgccaaagcactt
gctgatgccaaagtacaagcaaaagccgaagccgacaaactaaaagctaaccaagcggaa
gctgaacgtttgcgcaaagaaaaagccgatgccgatgccaaagcgcttgctgatgccaaa
gcacaagcaaaagccgaagccgacaaactaaaagccaaccaagcggaagctgaacgtttg
cgcaaagaaaaagctgatgccgatgccaaagcgcttgccgatgctaaagcacaagcaaaa
gccgaagccgacaaactaaaagccaaccaagcggaagctgagcgtttgcgtaaagaaaaa
gctgatgccgatgccaaagcgcttgccgatgcaaaagcacaagcaaaatccgaagccgac
aaactaaaagccaaccaagtggaagctgagcgtttgcgtaaagaaaaagctgatgccgat
gccaaagcgcttgctgatgccaaagcacaagcaaaatccgaagccgacaaactaaaagcc
aaccaagcggaagctgaacgtttgcgcaaagaaaaagctgatgccgatgccaaagcactt
gccgatgcaaaagcacaaacaaaatccgaagccgacaaactaaaagccaaccaagtggaa
gctgagcgtttgcgtaaagaaaaagccgaagccgatgccaaagcgcttgctgacgagaca
actgaacgcttgcgtaaggaagccgatgctaaagccaaaattgacgaagccaaaacaact
gaagacaaagaattagataacctaagccaagttctagaagactctaagaaaaatcagaag
caatcgttatctagattagactcgattacaaaagcaaaagataatgagcttaaggaactt
agaagagtaaatgatttgtctgataaaggtatcgtgagcgaagccaaagactttcaaaat
actagtgccgcaaatagagcattagaatcgttgaaaagcgaaatagccgaaagttctaaa
aatcaaaataattttatcaaagagtttgaaacacttacaaacgaaagattgaaaaaagtg
cctaatagaaatgatattgttaatcaaagtaatttaaaaagtcttgaaaaattaaagcta
gataaattaaatagcgacaaacaaaatgcagatttattaaccaaattagaaacaattaag
gccgaaacagttatcgagaaaagcagaagaatcaagcgagcacaatttgatagtgatgat
gcaaaatatcaaaaagatagagaaacacttaaagaaataaaaacaagtactgcaccaaca
ggtcagacttataaaccaacagatttcgattttggggaagaacaagcaggtacacaaatc
atcaaaaacaacgataatatacctgaaggatattatattgttatagcaatacacaaagat
gtagcaaaaagagacgcattcgttaaaaaagcaatacaagcaggtcaaaaagatatagac
tttttctataacgcaagtaatggaaattattatatttattatgatcgacaaaaccaaata
caagaggctacaactgccatggaaagcaaaggaagcaaaccatataatggtaaaatggtg
attgtgaaggtcgaaaaataa

DBGET integrated database retrieval system