KEGG   Flavobacterium psychrophilum JIP02/86: FP1063Help
Entry
FP1063            CDS       T00548                                 

Gene name
tdk
Definition
(RefSeq) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00240  Pyrimidine metabolism
fps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FP1063 (tdk)
Enzymes [BR:fps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FP1063 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-GeneID: 5298800
NCBI-ProteinID: YP_001295968
UniProt: A6GYI4
LinkDB All DBs
Position
complement(1132141..1132749)
Genome map
AA seq 202 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPTIDTRYDDEM
VVSHNKNEIRSTPVPAAANIAILAQGCDVVGIDEAQFFDDEIVKICNDLANSGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKTDNDKLVMLGETEEYEP
LSRAAYYNAMRENMIVKDAEHL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcagtttggttggattgaagttatttgc
ggatcgatgttttcgggtaaaaccgaggagttaattcgtagattaaaaagagcacaattt
gccaaacaaaaagtcgaaatttttaaacccactatcgataccagatatgatgacgaaatg
gtggtttcgcataacaaaaacgaaattagatctacgcctgttcccgcagctgcaaacatt
gccattttagcccaaggttgcgatgttgttgggattgatgaggcgcaattttttgatgac
gagattgtaaaaatttgtaatgaccttgccaattcaggcattagagttattgtggctgga
ttggatatggattttaaaggaaatccttttggccccatgccagcacttatggcaacggca
gaatatgttacaaaagtacacgccgtttgtacccgtacaggaaatttggccaattatagt
tttcgcaaaaccgataatgacaaactcgttatgcttggcgaaaccgaagaatacgaaccc
ttaagtcgtgccgcatattataatgccatgagagaaaatatgattgtaaaagatgctgaa
catttataa

DBGET integrated database retrieval system