KEGG   Flavobacterium psychrophilum JIP02/86: FP1064Help
Entry
FP1064            CDS       T00548                                 

Gene name
mur_alr
Definition
(RefSeq) Bifunctional enzyme : Mur ligase domain protein and alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00473  D-Alanine metabolism
fps01100  Metabolic pathways
fps01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FP1064 (mur_alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    FP1064 (mur_alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fps01011]
    FP1064 (mur_alr)
Enzymes [BR:fps01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FP1064 (mur_alr)
Peptidoglycan biosynthesis and degradation proteins [BR:fps01011]
 Precursor biosynthesis
  Racemase
   FP1064 (mur_alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-GeneID: 5299695
NCBI-ProteinID: YP_001295969
UniProt: A6GYI5
LinkDB All DBs
Position
complement(1129678..1132131)
Genome map
AA seq 817 aa AA seqDB search
MDPLTISLHNIIPILDANFQGIDENIYYDTISIDSRSLQNNENTLFFALVGPNNDAHIYI
GDLISKGVKNFVVTYIPKRLTGKANFLIVKNTLVALQIFARYYRNLFHFPIIGITGSNGK
TIVKEWLNFLLSPDYNIIRSPKSYNSQVGVPLSVIAINENHNLGIFEAGISTKDEMENLQ
KIIQPTIGILTNIGTAHDEGFADISEKIKEKLKLFTAVEVLILNKNKTIETFINKEINTF
TWSTNDQSADVFFQKKTLNDHALLNITNQGKYFKIKIPFIDEASLENSMHCILVMLYLKY
DLDTIKHRISQLFPVEMRLKVKNGINNCTLIDDSYSSDFQSLKIALDFLENQKQHLKKTL
ILSDIYQSGLENEDLYVRVSQLIISNKINRVICIGGVISKYKNKFLNVISYLSTNDFIED
FDNLDFTNETILIKGSRHFEFEKIVTLLEEKTHETVLEINLNAISHNLNYFKSKLNPKTK
IMVMVKAFGYGSGSFEIAKLLAHHKVNYLGVAFADEGIELRQAGIQLPIMVLNPEMTSFP
SIIQYNLEPEIYSIRGLKAFIKITQQKELTSYPIHIKINTGMNRLGFDAQIIPELISILQ
KHDSVLVKSILSHLAASDDLAQDIFTRKQISDFDTISNKITTKLKINPIRHISNTSAISN
YPQAQFDMVRLGIGLYGVSNDANETKKLENVGTLKSIISQIRNLNSGQSVGYNRRFMVKK
PTTIATIPIGYADGISRAWGNEVGYVLVNEQKAPIVGSICMDMLMIDVTKINCSEGNQVI
IFGKTPSVTTIAKATKTIPYEILTSISSRVKRVFYRE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
ttggacccattgactatatccttacacaatataattcctattctagatgccaattttcag
ggtattgacgaaaatatttactacgatactatctcgatagatagtcgttcgcttcaaaac
aacgaaaacactttgttttttgcactagttggtcctaataatgatgcccatatttatatt
ggagatttaatctccaaaggtgttaaaaactttgtagttacctatattcctaaaagatta
actggcaaagcaaattttttaattgtaaaaaacactcttgtagctttacaaatatttgcc
cgttattatcgtaatttatttcattttccaatcataggaattacaggaagcaacggaaaa
accattgtaaaagaatggcttaatttcttattaagtcctgattataatataattagaagt
cctaaaagctacaattcgcaagttggcgttcccctttctgtgattgcaattaatgaaaat
cataatttaggcatttttgaagccggaatttctaccaaagacgaaatggaaaatcttcaa
aaaataatacagccaaccattgggattttaaccaatatagggaccgctcatgatgaaggt
tttgctgatatttctgagaaaataaaagaaaaactcaagctatttactgccgtagaagtt
ttaattcttaataagaataaaaccatcgaaacttttattaacaaagagattaatactttt
acttggagtacaaatgatcagtctgccgatgttttttttcagaaaaaaacactcaatgat
catgctcttttgaatattacaaatcaggggaaatattttaaaataaaaattccatttatt
gatgaagcttcactagaaaacagcatgcattgcattttggtaatgttatatttgaagtat
gatttagatacaattaagcatcgtatttctcaattatttccagtcgaaatgcgattgaag
gtaaaaaacggaattaacaattgtactttaattgatgatagttatagttctgattttcag
tctttaaaaatagctttagattttcttgaaaatcaaaaacaacacttaaaaaaaacactc
attttatcagatatttatcagtcaggattagaaaacgaagacttatatgttcgtgtttct
cagcttattatttcaaacaaaataaatcgagtaatttgcattggaggtgtaatttctaaa
tataaaaacaagtttctcaatgtcatttcttacctttcaacaaatgattttattgaagat
tttgacaatctagattttacaaacgaaactattttaataaaaggatctcgacatttcgaa
ttcgaaaaaattgtaaccttactcgaggaaaaaacacatgaaacagttttagaaattaac
cttaatgccataagccataatttaaattacttcaaatcgaaactaaatcccaaaaccaaa
atcatggttatggtaaaagcttttggttacggaagtggctcatttgagattgccaaactc
ctcgcccaccacaaagtaaattatcttggtgtggcattcgccgatgaaggaatcgaactc
cgccaagcaggcattcaattacctatcatggttctaaatccagaaatgaccagtttccca
tcgataattcaatacaatttagaacccgaaatatatagtattcgaggtctgaaagcattt
ataaaaattacccaacaaaaagaacttaccagttatcctatacatattaagataaataca
ggtatgaatcgtttgggttttgatgcgcaaattattccagaactcatctcaatattacaa
aagcatgattcagttttggtaaaaagtattttgtctcatttagcggcaagcgatgattta
gcacaggatatttttacccgaaaacaaatttcagattttgatacaatatctaataaaatt
accacaaaattaaaaataaaccctattcgccatatttcaaacacctctgcaataagcaat
tatccgcaagcgcagtttgatatggttcgattaggcattgggttatatggcgtttctaat
gatgccaatgaaacaaaaaaacttgaaaatgtagggacactaaaatcgataatttcacaa
attcgcaatttaaacagtggccaaagcgtagggtataatagaaggtttatggtaaaaaaa
cctaccacaattgctacaatcccaataggctatgccgacggaatttcacgtgcttgggga
aatgaagttggttatgttttagttaatgaacaaaaagcccccatagtaggaagtatttgt
atggatatgctaatgatagatgtcacaaaaattaattgttctgaaggtaatcaagtaatt
atctttggcaagaccccatcagtaaccaccatcgcaaaagcaacaaaaacaataccttac
gaaatattaacaagtatttcaagcagggtaaaacgggttttttacagagaataa

DBGET integrated database retrieval system