KEGG   Flavobacterium psychrophilum JIP02/86: FP2215Help
Entry
FP2215            CDS       T00548                                 

Gene name
kynU
Definition
(RefSeq) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00380  Tryptophan metabolism
fps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    FP2215 (kynU)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     FP2215 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 5300761
NCBI-ProteinID: YP_001297072
UniProt: A6H1P7
LinkDB All DBs
Position
complement(2538726..2540003)
Genome map
AA seq 425 aa AA seqDB search
MIFQNTLEFAQQLDNQDELKEYKNEFIFPQHEGKNVIYFTGNSLGLQPKSARNYVDEVMN
DWANLAVEGHFYADKPWWDYQERFANPLSKIVGAKPLEVTVMNTLTVNLHLLMVSFYRPT
KKRYKIICEEKAFPSDQYMFQSQVNFHGYKPEDAIVEIKRREGEHNIRLEDILSKIEAVG
DELALVLFGGVNYYTGQVFDMKTITEAGHKQGAKVGFDLAHAAGNIKLELHDWNVDFAAW
CSYKYMNSGPGNASGCFVHEKHHSDSNLPRFAGWWGHNKERRFKMEPTFDPVHGADGWQI
SNLPILSLAPYLASVEMFAEVGIEKLIRKRNQITAYLEFILHEIDKEVKGHFEILTPTNQ
EERACQLSVFLHGEGRSLFDYLMKNGVVTDWREPNVIRLAPVPLYCSFEDMYNFGQILKK
GILEN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcaaaatacattagaattcgcacagcaattagacaatcaagacgagctaaaa
gaatataaaaacgaatttatctttccgcaacacgagggtaaaaacgttatttattttaca
ggaaattcattaggattacaacctaaatctgccagaaattatgtagatgaagtgatgaac
gattgggcaaacctcgctgtcgaagggcacttttacgcagacaaaccatggtgggattat
caggaacgttttgccaatcctttaagcaaaattgttggtgcaaaaccattggaagtaaca
gtaatgaacacccttacagtaaatcttcacttgcttatggtttccttttatcgtcctaca
aaaaaacgatataagattatttgcgaagaaaaagctttcccgtcagaccaatatatgttt
cagagtcaagtaaactttcatggatataaaccagaagatgcaattgtcgaaataaaaaga
agagaaggcgaacataatatacggctagaagatattttatctaaaatagaagcggtagga
gacgaattagcattagtcttatttggaggcgtaaattattatacaggacaagttttcgat
atgaaaaccattaccgaagcaggacacaaacaaggggctaaagttggtttcgatttggct
catgccgcaggaaacatcaaactagaattgcacgattggaatgtcgattttgcggcttgg
tgttcttataaatatatgaattcagggccaggaaacgcatcaggatgcttcgtgcacgaa
aagcaccatagcgattcaaacttgcctaggtttgcaggttggtgggggcacaacaaagaa
cgacgtttcaagatggaacctactttcgatccagttcatggtgccgatggttggcaaata
agtaatttgccaattctttcattggctccatatttagcatcagtagaaatgtttgcggaa
gttggaatagagaaattaatcagaaaaagaaatcaaattacagcttatttagaatttatt
ctccacgaaatagacaaagaagtaaaaggccatttcgaaattttaacaccaactaatcag
gaagaaagagcttgtcagctctcagtgttcttgcacggagaaggacgttctttattcgat
tatttaatgaaaaacggggttgttacagattggcgtgaacctaatgtaattcgcttagcg
ccagttcctttgtattgctcttttgaagatatgtacaattttggacaaatattaaaaaaa
ggaattttagaaaattaa

DBGET integrated database retrieval system