KEGG   Flavobacterium psychrophilum Z2: AMR72_04580Help
Entry
AMR72_04580       CDS       T04556                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fpsz  Flavobacterium psychrophilum Z2
Pathway
fpsz00473  D-Alanine metabolism
fpsz00550  Peptidoglycan biosynthesis
fpsz01100  Metabolic pathways
fpsz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMR72_04580
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMR72_04580
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AMR72_04580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fpsz01011]
    AMR72_04580
Enzymes [BR:fpsz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AMR72_04580
Peptidoglycan biosynthesis and degradation proteins [BR:fpsz01011]
 Precursor biosynthesis
  Amino acid ligase
   AMR72_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATP-grasp RimK ATPgrasp_ST GARS_A ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ALM48237
UniProt: A0A0P0U7C6
LinkDB All DBs
Position
1060583..1061569
Genome map
AA seq 328 aa AA seqDB search
MNVAVVMGGYSDESVISIRSGQLILKNLDRNKYTPYEIHILPEGWNVLVDGNKYPINKGD
FSFEKEGGKVTFDVAVNTIHGTPGEDGHMQSYWELIDLPYTGCGFYQSALTFNKRDTLSV
LSKFNIPKAKSIYLSKGDVVTAQQIVETLGLPFMVKPNQSGSSLGVSKVNEISEFDKALN
FAFAEDSDILIEEYIKGTEVSVGVLNLNGKTTVLGLTEIVSHNDFFDYEAKYQGKSDEIT
PARIDAETERKVRETAAKAYEALGMSGFSRTDFIIRNGEPHFIEINTNPGLSQQSIFPQQ
AQHADIPFTELLDSEIKLALQRKVLWKK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtagcagtagtaatgggcggatattcagacgaatccgttatttctatccgaagc
ggccagcttatattaaaaaatcttgaccgtaataaatataccccttatgagatacatatc
cttcctgaaggatggaatgtgcttgtagatggcaacaaatatcctataaacaaaggagat
ttttcttttgaaaaagagggcggcaaagttactttcgacgttgcggtaaatactattcac
ggaacaccgggcgaagacggacacatgcaatcgtattgggaactgatagaccttccatac
accggatgcggtttttaccaatcggcacttacattcaataaaagagataccttatcggta
ctttcaaaattcaatatacccaaagcaaaatcaatctatctttctaaaggagatgttgta
actgcccaacagatagtcgaaacgcttggcctgccttttatggtaaagccaaaccaaagc
ggaagcagccttggcgtttctaaagtaaatgaaatttcagaatttgataaagctttgaat
tttgcatttgctgaagattcagatatccttatcgaagaatatattaaaggtacagaagta
tctgtcggggtgcttaaccttaacggaaaaacaaccgttcttggtttaaccgaaattgta
tcgcacaacgacttttttgactacgaggccaaataccagggaaaatcggatgaaataaca
cctgcacgtattgatgccgaaacggaaaggaaagtgcgcgaaacagcagccaaagcttat
gaagctttgggaatgagtggcttttcccgtaccgattttataatcagaaacggcgaacct
cattttatagaaataaataccaacccgggactatcacaacaaagtatttttccgcagcaa
gctcagcatgccgatataccgtttactgaattgctcgacagcgaaattaaactggcgtta
cagcgtaaagtactttggaagaaataa

DBGET integrated database retrieval system