KEGG   Flavobacterium psychrophilum Z2: AMR72_07145Help
Entry
AMR72_07145       CDS       T04556                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fpsz  Flavobacterium psychrophilum Z2
Pathway
fpsz00380  Tryptophan metabolism
fpsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AMR72_07145
Enzymes [BR:fpsz01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AMR72_07145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 SHMT DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ALM48688
UniProt: A0A0P0U937
LinkDB All DBs
Position
complement(1628170..1629450)
Genome map
AA seq 426 aa AA seqDB search
MDFQNTREYAQQLDAKDKLAKYREEFHFPHVNGKQVVYFTGNSLGLQPKRTKAYIDEIMD
DWAKLAVEGHFYADKPWWDYHERFAVPLSKVVGALPSEVTVMNTLTVNLNLLMVSFYNPT
AKRFKIICEEKAFPSDQYMLQNQVKFHGLNPDDAIVQIKRREGEHNIRLEDVLAKINEVG
DELALVLLGGVNYYTGQVFDMKTITKAGQDAGAYVGWDLAHAAGNIALELHDWNVDFAAW
CSYKYMNSGPGNASGAFVHEMHHNDMDLKRFAGWWGHNKERRFLMEPNFDPIRGANGWQV
SCLPVLSLAPYLASVEMFDEVGMPALIAKRDQITAYLEFILHEIDREVKGNFEVITPADP
KERASQISVFLHGEGRSLFDYLMKQGVITDWREPNVIRLAPVPLYCSFEDMYEFGQVLKQ
GILSHK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggattttcaaaatacacgagaatacgcacagcagcttgacgccaaagacaaactggct
aaatatagagaagaatttcattttccgcatgtaaacggtaaacaggttgtctactttacg
ggtaactcacttgggcttcagcctaaacgtactaaagcctatatcgacgaaattatggac
gactgggctaagctggctgtagaaggacacttctatgcagataagccttggtgggactac
cacgaacgttttgcagtgccgcttagtaaggttgttggtgctttaccatctgaagtgacg
gtaatgaatacccttactgtaaaccttaaccttttgatggtgtcattttacaatcctacc
gctaagcgatttaagatcatttgcgaggagaaggctttcccgagcgaccagtatatgctt
cagaaccaggttaaattccacgggcttaatcctgatgatgccattgtacaaattaaaagg
cgtgaaggcgaacacaatattcgccttgaggacgttcttgccaaaataaacgaagtaggt
gatgagcttgcccttgtgcttttgggtggtgtaaactactatacaggccaggtgtttgat
atgaaaaccataactaaagcgggtcaggatgccggtgcctatgtaggttgggatcttgca
cacgcagcgggaaatatagcgttggaacttcacgactggaatgtagacttcgccgcatgg
tgcagttataaatacatgaattcagggccgggtaacgcgtcaggggcatttgtacacgaa
atgcaccataacgatatggacctgaaacgttttgccggatggtggggacataacaaagaa
cgccgtttcttaatggagcctaatttcgaccctattcgtggggcaaacggctggcaggtt
agctgtcttccggtgctttcgctggcgccgtatttggcatcggtagaaatgtttgatgag
gttggtatgccggcacttatcgctaagcgtgaccagataactgcttaccttgaatttatc
cttcatgaaattgacagggaggttaaaggtaattttgaagttatcactcctgcagatcct
aaagaaagggcaagccagatatcggtattccttcatggagagggaagatcgttatttgac
tacctgatgaaacagggtgttattaccgattggagagagccaaatgttatacgccttgct
ccggtaccactatactgttcatttgaagatatgtatgaatttggacaggttcttaaacag
ggaattttatcacataaataa

DBGET integrated database retrieval system