KEGG   Flavobacterium psychrophilum Z2: AMR72_08690Help
Entry
AMR72_08690       CDS       T04556                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fpsz  Flavobacterium psychrophilum Z2
Pathway
fpsz00020  Citrate cycle (TCA cycle)
fpsz00310  Lysine degradation
fpsz00380  Tryptophan metabolism
fpsz01100  Metabolic pathways
fpsz01110  Biosynthesis of secondary metabolites
fpsz01120  Microbial metabolism in diverse environments
fpsz01130  Biosynthesis of antibiotics
fpsz01200  Carbon metabolism
Module
fpsz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpsz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMR72_08690
  Amino acid metabolism
   00310 Lysine degradation
    AMR72_08690
   00380 Tryptophan metabolism
    AMR72_08690
Enzymes [BR:fpsz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AMR72_08690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N DUF3837
Motif
Other DBs
NCBI-ProteinID: ALM50738
UniProt: A0A0P0UEB3
LinkDB All DBs
Position
complement(1985225..1988017)
Genome map
AA seq 930 aa AA seqDB search
MDRFSFLNAAHTAFFADLYDQYIENPDSVEPSWRSFFQGFDFGSESYGSGFETLDVPGQA
ATVAAQPVSDYSGIPEKLQKEFKVLNLIEGYRTRGHLFTKTNPVRDRRIFTPSLALDNFG
LSDADLDTVFDAGKEVGLQNATLKQIVDHLRQVYCQHIGIEYMYIRDPEVRKWIQNKLSA
NNNQPDFSAEQKKNILGKLNEAVSFENFLHTKYVGQKRFSLEGGESLIPALDALIEAAAD
KGVEQFVMGMAHRGRLNVLANVFGKSTSDIFSEFDGKDYDDDALFDGDVKYHLGLTADKQ
TRNGKHININLAPNPSHLETVGAVIEGIARAKQDRHYADDFSKVLPIALHGDAAVAGQGI
VYEIVQMAKLDGYKTGGTIHLVVNNQVGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADD
AEAVVHAMMFALDYRMEFGSDVFIDLLGYRKYGHNEGDEPRFTQPKLYKIIAKHKNPRDI
YAEKLVEAGVIAADYVGGLEKEYKAKLEENLEASRKKDLTIITPFMLNEWEGYEQADEQE
MLKKVNTAFSKDILTDIAKVITELPSDKKFINKIQKLINDRKNMYFETDKLDWAMAELLA
YGSLLTEGYDVRISGQDVERGTFSHRHAVVKVEDSEEEVILLNNLKDQKGKFHIYNSLLS
EYGVVGFDYGYALASPKTLTIWEAQFGDFSNGAQIMLDQYISAAEDKWNNQNGLVMLLPH
GYEGQGAEHSSARMERYLQLCANHNMYVADCTTPANFFHLLRRQMKTNFRKPLIVFTPKS
LLRHPLVVSTVDEFANGSFQEVLDDPAADANKVKTLVFVTGKFYYDLIAERENLNRDDVA
FVRIEQLFPLPVEQIKEIIAKYPNADDYVWAQEEPRNMGAYSYMLMNFTEVKFRLAALKA
YSAPAAGSYTRSKKRHAAAIAMVFDKNLFN
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggacaggttttcctttttaaacgcagcacatactgctttttttgcagatttatacgat
caatatatagagaatcccgacagtgttgaaccaagctggagaagttttttccaggggttt
gattttggtagtgagagctacgggtctggtttcgaaacgctggatgtgccaggtcaggca
gctacagtagcggcccagcctgtttctgattactcgggtattcccgaaaaacttcaaaaa
gaatttaaggttttaaaccttatcgaaggttaccgtacacgcggccacctgtttaccaaa
accaatccggttagggacaggaggatttttaccccatcgttagcacttgacaattttggc
ctttctgatgccgatcttgatactgtgtttgatgcaggtaaagaggtagggcttcaaaac
gcaacccttaaacagatcgttgaccatttaaggcaggtatactgccagcacattggtatc
gagtacatgtacatccgtgacccggaagtacgcaaatggattcagaacaaactttctgct
aacaataaccaaccggatttctctgcagagcagaagaaaaacattctgggcaaacttaat
gaggctgtttcttttgagaacttccttcatacaaaatacgttggacagaaacgtttctca
cttgagggtggagaatcgcttattcctgcacttgatgcacttattgaggcagctgcggat
aaaggtgtagagcaatttgttatgggtatggcgcacaggggtcgccttaacgtacttgca
aacgtatttggtaagtcaacttctgatatcttcagcgagtttgacggtaaagactacgat
gacgatgctctttttgatggcgacgtaaaataccaccttggccttacggcagacaaacaa
acaaggaacggtaaacatataaacattaaccttgctccaaacccttcgcaccttgaaact
gtaggtgcagttatagaaggtattgcaagggctaaacaggacaggcactatgccgacgat
ttctctaaagtgttacctatcgcgcttcacggtgatgccgctgttgccggtcagggtatt
gtttacgaaattgttcagatggctaagcttgacggttacaaaaccggaggtacaattcac
cttgtggtaaataaccaggtaggttttacaaccaactatcttgatgcacgttcgtctacc
tattgtacagacgttgctaaagtaacattatcaccggtacttcacgtaaatgcagacgat
gcagaagcggtagttcatgctatgatgtttgccttagactacaggatggaatttggcagc
gatgtatttattgaccttttagggtacagaaaatacggtcacaacgaaggtgatgagcct
cgttttacgcagcctaaactatacaagattatcgctaagcacaaaaatccaagggatatc
tatgctgaaaagctggtagaagccggagttattgctgctgattacgttggcggacttgaa
aaagaatacaaagccaaacttgaggaaaaccttgaagcatcaagaaaaaaagaccttacc
atcattactccgttcatgctgaacgagtgggaaggatatgagcaggctgacgagcaggaa
atgcttaaaaaagtaaacactgctttctctaaagatatacttaccgatatcgctaaagtt
ataacagagcttccttctgataaaaagtttataaacaagattcaaaagcttataaacgat
agaaagaacatgtactttgaaacggataaactggactgggctatggccgagcttcttgct
tacggatcattgcttacagagggttatgacgtgcgtatctcaggacaggatgtagagagg
ggaaccttttctcaccgtcatgcggtagttaaagttgaagattctgaagaagaagtaatt
cttcttaataacctgaaagaccagaaaggtaaattccatatttacaattcactgctttca
gaatatggtgttgtaggttttgattatggttatgcccttgcaagccctaaaacacttacc
atttgggaggcccagtttggtgacttctctaacggtgcgcaaatcatgctggatcagtat
atatctgctgccgaagacaaatggaacaaccagaacggacttgtaatgttattgcctcac
ggttacgaaggccagggtgcagaacactcttctgcacgtatggagcgttaccttcagctt
tgtgcaaaccacaatatgtatgtggcagactgtacaacgccggcaaacttcttccacctt
ttaagaaggcagatgaaaacaaacttccgtaagccgcttatcgtgtttacacctaagagc
ttactacgtcatccgcttgtagtttctacagtagatgaatttgcaaacggaagcttccag
gaagtgcttgacgatcctgcagcagatgctaacaaagtaaaaacacttgtatttgttaca
ggtaaattctactacgaccttattgcagaaagggaaaaccttaaccgtgatgatgtagct
tttgtaaggatagagcagttattcccattaccggtagaacagattaaagaaattatagct
aaatatcctaatgccgatgattatgtatgggcacaggaagagccaagaaacatgggtgct
tacagctacatgcttatgaactttacggaagtgaaattcaggcttgcagcccttaaagct
tacagtgcaccggcagcaggtagctacacacgttctaaaaaacgtcatgcagctgctata
gcaatggtttttgataaaaacttatttaattaa

DBGET integrated database retrieval system