KEGG   Flavobacterium psychrophilum Z2: AMR72_11625Help
Entry
AMR72_11625       CDS       T04556                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fpsz  Flavobacterium psychrophilum Z2
Pathway
fpsz00240  Pyrimidine metabolism
fpsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AMR72_11625
Enzymes [BR:fpsz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AMR72_11625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: ALM49491
UniProt: A0A0N7K933
LinkDB All DBs
Position
complement(2665700..2666320)
Genome map
AA seq 206 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLNRAKFARQKVEIFKPAIETRYHEEM
VVSHDANQIRSTPVTSSAMMKLLAQGCDVVGIDEAQFFDDEIVTVCNDLANSGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKANNDNLVLLGETEEYEP
LSRAAYYAAMRNSTASKGNEDKAESL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcataaagaacaattcgggtggatagaggttatctgc
gggtcgatgttttcgggaaagaccgaagaactgatacgcaggctgaacagggcaaaattt
gcccgtcagaaagtagaaatatttaaacctgccatagaaacccgctaccacgaagaaatg
gtggtatctcacgatgccaaccagatacgttctacacctgttacttcatcggccatgatg
aagcttttggcacagggttgcgatgtagtagggatagacgaagcccagttttttgatgat
gagattgtaacggtttgtaacgaccttgccaacagcggcatacgtgttattgttgccgga
ctggatatggactttaaaggaaatcctttcggccccatgcctgcgcttatggctactgcc
gaatatgttaccaaagtacacgccgtttgtacccgcaccggcaaccttgccaactatagc
ttccgtaaagccaataatgacaatctcgtattgctgggcgaaaccgaagaatacgaacct
ttaagcagggcggcttattatgcggcgatgagaaactcaacagcctctaaaggaaatgag
gataaggctgaatctttgtga

DBGET integrated database retrieval system