KEGG   Flavobacterium psychrophilum Z2: AMR72_13250Help
Entry
AMR72_13250       CDS       T04556                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fpsz  Flavobacterium psychrophilum Z2
Pathway
fpsz00010  Glycolysis / Gluconeogenesis
fpsz00020  Citrate cycle (TCA cycle)
fpsz00620  Pyruvate metabolism
fpsz01100  Metabolic pathways
fpsz01110  Biosynthesis of secondary metabolites
fpsz01120  Microbial metabolism in diverse environments
fpsz01130  Biosynthesis of antibiotics
fpsz01200  Carbon metabolism
Module
fpsz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMR72_13250
   00020 Citrate cycle (TCA cycle)
    AMR72_13250
   00620 Pyruvate metabolism
    AMR72_13250
Enzymes [BR:fpsz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMR72_13250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H QRPTase_N DUF2118
Motif
Other DBs
NCBI-ProteinID: ALM49782
UniProt: A0A0P0UBF1
LinkDB All DBs
Position
3026986..3028659
Genome map
AA seq 557 aa AA seqDB search
MAKIITMPRLSDTMTEGTVATWLKKVGDTIKEGDILAEIETDKATMEFEAFDAGTLLHIG
IQEGETAPVDSVLAVIGKEGEDISGLLEGKAAPAADSDKKEEPKKEEKADEAKTEEKPAE
EKKAAPAAAGLPEGVIVVTMPRLSDTMTEGTVATWLKKEGDTVKEGDILAEIETDKATME
FESFNAGTLLKIGIQEGQTAPVDSLLAIIGPAGTDVSGVTGKEGSNPAAESKSEEAPKED
KKEEAAPAPKAEEAAPATNDSGRLFVSPLARKIAEEKGVNLNQVKGSGENGRIVKKDIES
YTPQAAQPAAQATAPQGAAKAEAKPFVPAGEVSTEEVKNNQMRKTIARRLAESKFTAPEY
SLTIELDMDNAIASRGVINAVPDTKVSFNDLVVKACAMALRKHPQVNTQWKDDVTVYNKH
ISIGVAVAVEDGLLVPVLKFTDNMSLSQIGATVKDLAGKAKNKKLAPADMEGSTFTVSNL
GMFGIQEFTSIINQPNSAILSVGAIIQKPVVKDGQIVVGNVMKVTLTCDHRTVDGATGAQ
FLQTLKQYIENPVTMLA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagattataactatgccgcgtcttagcgacactatgaccgaaggtactgtggct
acgtggcttaaaaaagttggtgatacaattaaagaaggagatatccttgcagagattgaa
acagataaagctacaatggaatttgaagcttttgatgcaggtacacttttacacattgga
attcaggaaggtgaaactgctccggtagattcagttcttgctgttatcggtaaagaaggt
gaagatatttcagggcttcttgaaggtaaggcagctcctgctgctgattctgataaaaaa
gaagagcctaagaaagaagaaaaagctgatgaagctaaaacagaagaaaaacctgccgaa
gagaagaaagctgcacctgctgctgccggacttcctgaaggtgttattgtagttactatg
cctcgccttagtgatactatgaccgaaggtactgttgctacatggcttaaaaaagaaggt
gatactgtaaaagaaggtgacatccttgcagaaattgaaacggacaaagctactatggag
tttgaatcgtttaatgcaggtacactacttaaaataggtatccaggaaggacagactgct
ccggtagacagccttctcgcgattattggccctgcgggaacagatgtttccggtgttaca
ggtaaagaaggaagcaatcctgctgctgaaagcaaatcggaagaagctcctaaagaagat
aaaaaagaagaagcggcaccagctccaaaagctgaagaggctgctcctgcaactaacgat
agcggaagactatttgtttctccgttagcacgtaagatcgccgaagaaaaaggcgttaac
cttaatcaggttaaaggttctggtgagaacggtcgtatcgttaaaaaagatattgaaagc
tatacaccacaggctgcacagccggcggctcaggctactgctccgcaaggtgctgcaaaa
gctgaggctaaaccatttgttcctgctggtgaagtaagtaccgaagaagtgaaaaacaac
caaatgcgtaaaactattgcgcgtcgtctggctgaatctaaattcactgctccggaatac
agccttactatagagcttgatatggataacgctattgcttcgagaggtgttattaatgca
gtgccggatactaaagtgtcatttaacgaccttgtagttaaagcatgtgctatggctttg
agaaaacaccctcaggttaatacccagtggaaagatgatgttactgtttacaacaaacac
attagcattggtgttgctgttgctgttgaagacggacttcttgtaccggtacttaaattt
accgacaacatgagcctttctcaaattggtgctacagtgaaagaccttgcaggtaaagcg
aaaaacaaaaaacttgctcctgcagatatggaaggcagcacgtttaccgtttctaactta
ggtatgtttggtattcaggagtttacatctattatcaaccagcctaactctgcaatcctt
tcagtaggtgctatcatacagaaacctgttgttaaagatggtcagatagttgtaggtaat
gtaatgaaagtaactcttacatgcgaccacagaacagttgatggcgctacaggagctcag
ttccttcaaacgcttaaacaatatattgaaaatccggttactatgctggcataa

DBGET integrated database retrieval system