KEGG   Flavobacterium psychrophilum Z2: AMR72_14560Help
Entry
AMR72_14560       CDS       T04556                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
fpsz  Flavobacterium psychrophilum Z2
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fpsz02000]
    AMR72_14560
Transporters [BR:fpsz02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    AMR72_14560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 AAA_29 RecA AAA AAA_16 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ALM50012
UniProt: A0A0P0UAW2
LinkDB All DBs
Position
3299237..3300163
Genome map
AA seq 308 aa AA seqDB search
MEPILEVKNVVKQYGDYTALNNVSLQVPRGSIYGLLGPNGAGKTSLIRIINQITMPDSGE
VFLDGEKLNPSHIGHIGYMPEERGLYKTMKVGEQALYLAQLKGLSKKEAKAQLEYWFEKL
EIQGWWNKKIQELSKGMAQKIQFVVTVLHQPKLLIFDEPFSGFDPVNANLIKDEILGLRD
KGATIIFSTHRMESVEEMCDHIALIHQSNKLIEGELNDVKKRYRTNTFEVGVVTNNNHQF
TGELSQKYQVAPANFKTLDDELKLLVTLPEGVSSRQLLSELVQKGDVTYFVEKIPSVNDI
FIQTVSKK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaattcttgaagtaaaaaacgtagttaagcaatacggcgattacaccgctctt
aacaatgtttcactgcaggtgccaagaggcagcatatacggacttttaggtcctaacggg
gcgggaaaaacatcccttatccgaatcatcaatcaaattacgatgcccgatagtggcgag
gttttccttgacggggaaaaacttaacccaagccatattggccacataggctatatgccg
gaagaaagaggtttgtataaaaccatgaaagttggcgagcaggctttataccttgcccag
cttaaaggcctatctaaaaaagaagccaaagcacaactggaatactggtttgaaaaactg
gaaattcagggctggtggaataaaaaaatacaggagctgtctaaaggtatggcgcaaaag
atacagtttgtggttacggtgctgcaccagccaaagctgcttatttttgatgaacccttc
agtggatttgaccctgttaatgccaatcttataaaagacgagatattagggcttcgcgat
aaaggcgcaactattattttttctacccacagaatggaaagtgttgaagaaatgtgcgat
catattgcgcttatccatcaatcgaacaaacttattgaaggcgagctaaacgatgtgaag
aaaagatatcgtaccaatacgtttgaagtgggggttgttaccaataacaaccatcagttt
acaggagagttaagccagaaatatcaggtggctccggccaactttaaaacacttgacgat
gaacttaagcttttagtgacactaccggaaggtgtaagctcacgccagttgctaagtgag
cttgtgcaaaaaggcgatgtaacctactttgtagaaaagattccaagtgttaacgatata
tttattcaaaccgtaagcaaaaaataa

DBGET integrated database retrieval system