KEGG   Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L: BZ13_1128Help
Entry
BZ13_1128         CDS       T03764                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpt  Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L
Pathway
fpt00250  Alanine, aspartate and glutamate metabolism
fpt00410  beta-Alanine metabolism
fpt00430  Taurine and hypotaurine metabolism
fpt00650  Butanoate metabolism
fpt01100  Metabolic pathways
fpt01110  Biosynthesis of secondary metabolites
fpt01120  Microbial metabolism in diverse environments
fpt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fpt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BZ13_1128
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BZ13_1128
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BZ13_1128
   00430 Taurine and hypotaurine metabolism
    BZ13_1128
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BZ13_1128
Enzymes [BR:fpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BZ13_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI74183
UniProt: C6YTR0
LinkDB All DBs
Position
complement(1150766..1152106)
Genome map
AA seq 446 aa AA seqDB search
MALHAKNNIKHKLYKESLPKFEIPKKSNDAFEAYQQIKDELMLDGNSKQNLATFCQTEVD
DFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAAML
GGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSSESLIMTPE
TMLKYCDENTIGVVPTLGVTFTGQYEPVEAVCEALDKFERETGINIPVHVDAASGGFLAP
FVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVVWADKKYLPQDLIFNVNYLGGDMPT
FALNFSRPGGQIVAQYYNFVKLGFEGYKNIHKLSYDVAKYIAKEIKDMGIFDIIHAGKGG
IPAVSWSLKAGKSYDLFDISEKIRARGWQIAAYSMPKDRQDLVVMRVLVRRGFSFDLAEL
MIRDLKNVINSLDNKSKDIERGGFSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggctttacatgccaaaaataatatcaaacataagttgtataaagaatcattgccaaaa
tttgaaattcccaaaaaatcaaatgatgctttcgaagcatatcaacaaatcaaagatgag
ttaatgctcgatggtaattcaaagcagaatttggcgacattttgtcaaacagaagttgat
gatttcattcacaagcttatggatgattgcattgataaaaatatgattgataaagatgaa
tatcctcaaactgcagaaatagagtcgcgatgtgtcaatatattagcaaacctatggaac
tcttcagcagaaaatgcaattggctgctcaactactggctcatctgaagctgctatgctt
ggcggtatggcgatgaaatggcgctggagagataagatgaaagcacaaggtaaagattat
acaaaacctaatcttgtcacaggacctgtgcaagtctgctggcataaatttgctagatat
tgggatattgagcttagagagattccaatgtcgagtgaaagtttaataatgactccagaa
actatgcttaagtactgtgatgaaaatacaatcggagttgtgcctactttgggtgttacc
tttacaggtcagtatgagcctgttgaggctgtttgtgaagcacttgataaatttgagaga
gagacaggtattaatattccagtacatgtagatgctgcttctggaggctttttggcacca
tttgtagagcctgagctgaagtgggattttagattaccaagagttaagtcaattaattca
tcaggacataagtttggtctatcgccgttaggggtaggttgggttgtttgggcagataag
aaatacttgccccaagatttgatttttaatgttaattatcttggtggcgatatgccgaca
tttgctttgaatttctctcgaccaggtggtcagatagttgcccagtattataactttgtt
aagcttggttttgaagggtataaaaatattcataagcttagttatgatgttgcaaaatat
attgctaaagaaattaaggatatgggtatctttgatattattcatgctggtaaaggtggt
atcccagcggtgagttggtcacttaaggcaggcaaaagttatgatttgtttgatatctct
gaaaaaattcgtgctagaggttggcagatagctgcttattcgatgccaaaagatagacaa
gacttggtagttatgcgagtgcttgttaggagaggctttagctttgatttagcagagctt
atgattagggatctaaaaaatgttattaattctttagataataaatctaaagatatcgaa
agaggtggtttttcgcattag

DBGET integrated database retrieval system