KEGG   Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L: BZ13_807Help
Entry
BZ13_807          CDS       T03764                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
fpt  Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L
Pathway
fpt00061  Fatty acid biosynthesis
fpt00780  Biotin metabolism
fpt01100  Metabolic pathways
fpt01212  Fatty acid metabolism
Module
fpt_M00083  Fatty acid biosynthesis, elongation
fpt_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:fpt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BZ13_807 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BZ13_807 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fpt01004]
    BZ13_807 (fabZ)
Enzymes [BR:fpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BZ13_807 (fabZ)
Lipid biosynthesis proteins [BR:fpt01004]
 Fatty acid synthase
  Component type
   BZ13_807 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF2187 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AJI75464
UniProt: C6YUK5
LinkDB All DBs
Position
complement(790614..791105)
Genome map
AA seq 163 aa AA seqDB search
MSQFDEKNKHIDVMGIRKILPHRYPFALLDKIVDWSIEDRTIVAHKNVTINEDFFNGHFP
EFPVMPGVLIVEAMAQATAILGELMAETLFAHVVAKAGGGRRTFMLAGIDKVRVKRPVVP
GDVLVIESRMVKQKNIICTAESVAKVDGQIVCSAELMAAYKDY
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtttgatgaaaaaaataagcatatagatgtaatggggattagaaagatttta
cctcataggtatccttttgctcttttagacaagattgttgattggagtattgaagataga
acgatcgtagctcataaaaatgtaactattaatgaagacttttttaatggacattttcca
gagtttccagtgatgcctggtgtactaattgttgaggctatggctcaagcaacagctata
cttggtgagttgatggccgagactttatttgctcatgttgttgccaaagctggtggtgga
agaagaacatttatgctagcaggtattgataaggtaagagtaaaaagaccagttgttcca
ggtgatgttctagttattgaatcacgtatggttaagcagaagaatattatctgtacagct
gagtctgtagctaaagttgatggacaaatagtttgttcagctgaattaatggcagcatat
aaggattattaa

DBGET integrated database retrieval system