KEGG   Fusarium pseudograminearum: FPSE_00171Help
Entry
FPSE_00171        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00730  Thiamine metabolism
fpu00790  Folate biosynthesis
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FPSE_00171
   00790 Folate biosynthesis
    FPSE_00171
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FPSE_00171
Exosome [BR:fpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FPSE_00171
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fpu00537]
 Enzymes
  FPSE_00171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 20358791
NCBI-ProteinID: XP_009251566
UniProt: K3VUX6
LinkDB All DBs
Position
2
AA seq 563 aa AA seqDB search
MSSPQANESDPLLSGSGHDRSDTQAESKAHRNSRLRELGLFAWALIATAAVIVVAIWTQH
EQQTKHDHNTPATKRNLVFMVSDGMGPATLSLTRSYRQHVEDLHFGDTLTLDKHFWGTSR
TRSNSSLVTDSAAGATAFSCGKKTYNGAISTLPNHDPCGTVLEAAKRAGYHTGLVVTTKI
EDATPACFNSHVVLREMEDEIALQQIGEGVLGRTVDLMLGGGRCNYLPSSAEGSCRADDT
DVVKIAKEKHNWTYADDRAGFDTLKGGNNVKLPFLGLFASSDIPFEIDRRNHNDVYPSLS
EMAKTALRALEKATEKSDKGFFIMIEGSRIDHAGHINDPAAQVHEVLEYDKTFRAVLDFI
KESKTETVLVATSDHETGGLATALQEPGHLPVYNWYPKVLANATASAEWLHAKLNAHIAS
NSEAKKNKQKLKEYINEELIIRGLGISNASDKEITTIAEHPESALVLFSALISLRAHIGW
STHGHTAVDVNIYSSGGPRTENIRGNVENTDVGKYLREYLEVDVDAITEELQDKMSKIKV
QDAGMEALDEVWPLGNKHHAIQG
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcctcaggccaacgaaagcgatcctctcttgtccgggtccggtcacgaccgc
tccgatacccaggccgaaagcaaggcccatcgaaactcgcgtctccgtgagctcggcttg
tttgcctgggctttgatcgctactgccgctgttatcgtcgtcgctatctggacccaacat
gagcagcagacaaagcatgaccacaacacgcctgcaacgaagcgaaatctcgtcttcatg
gtgtcagatggcatgggtcccgctacattgtccttgactcgcagctaccgacagcacgtt
gaagatctccattttggcgataccctcaccctcgacaagcatttctggggcacgagcagg
actcgctccaacagctcccttgtcaccgacagcgctgccggtgccactgccttctcctgc
ggcaagaagacctacaacggtgccatttctactctgccaaaccacgatccttgcggaacg
gtcttggaagctgcaaagcgcgctggataccacactggtctcgttgtgactacgaagatt
gaggatgcgactccagcctgcttcaactcgcacgttgtgctccgtgaaatggaagatgag
attgctcttcagcagatcggagagggtgtactcggacggaccgtcgacctgatgcttggt
ggtggtcgctgcaactacctgcctagcagcgcggagggcagctgccgagctgacgatacc
gacgtggtcaagattgcaaaggaaaagcacaactggacctacgctgatgaccgggctggt
tttgatactctcaagggtggcaacaatgtgaagctgcctttcctcggactgtttgcgtca
agcgacatccccttcgagattgaccgccgaaaccacaacgatgtctacccttcgctgagc
gaaatggctaagactgctcttcgtgctcttgagaaggctactgagaagagcgacaagggc
ttcttcatcatgattgagggcagccgaattgaccatgctggtcacatcaatgatcccgcc
gctcaggtccacgaggttcttgagtacgacaagaccttccgagctgtcctcgacttcatc
aaggagagcaagaccgagactgtcctcgttgcaaccagcgatcacgaaacaggtggtctt
gctaccgcgcttcaggaacctggccacctccctgtttacaactggtaccccaaggtcctt
gccaacgcgactgcctcagctgagtggctccacgcgaagctcaacgcccatatcgcctct
aactctgaggccaagaagaacaagcaaaagctcaaggagtacattaacgaggaactcatt
atccgtggtctcggtatctccaacgcctcagacaaggagatcaccacaattgcagagcac
cctgagagcgcccttgtcctgttctcagccctcatttctttgcgtgcacacattgggtgg
agcactcacggccataccgcagttgatgtcaacatctacagctctggcggaccccgaaca
gagaacatccgcggtaacgtggagaacaccgacgtgggcaagtatctgcgcgagtacctc
gaggttgacgtcgacgccatcaccgaggaattgcaggacaagatgagcaagatcaaggtt
caggatgcaggtatggaagccctcgatgaggtatggcctcttggaaacaagcaccacgct
atccagggttag

DBGET integrated database retrieval system