KEGG   Fusarium pseudograminearum: FPSE_00184Help
Entry
FPSE_00184        CDS       T03456                                 

Gene name
PKAC
Definition
(RefSeq) PKAC
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu04113  Meiosis - yeast
fpu04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    FPSE_00184 (PKAC)
  09143 Cell growth and death
   04113 Meiosis - yeast
    FPSE_00184 (PKAC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpu01001]
    FPSE_00184 (PKAC)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fpu03019]
    FPSE_00184 (PKAC)
   03036 Chromosome and associated proteins [BR:fpu03036]
    FPSE_00184 (PKAC)
Enzymes [BR:fpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     FPSE_00184 (PKAC)
Protein kinases [BR:fpu01001]
 Serine/threonine kinases: AGC group
  PKA family
   FPSE_00184 (PKAC)
Messenger RNA biogenesis [BR:fpu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     FPSE_00184 (PKAC)
Chromosome and associated proteins [BR:fpu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    FPSE_00184 (PKAC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 20358804
NCBI-ProteinID: XP_009251579
UniProt: K3VV82
LinkDB All DBs
Position
4
AA seq 584 aa AA seqDB search
MPSLGFLKKKRTREGNSDPSASSPTSPVTPTTSRSKSISKAFHLPRNNRHSTSAPTAQPT
NAQQQSQQQPEHQHQEGAAPQSNQPPAQNQQTAGASDGQQDHDMDTVKLHKPEYGTNSMS
PHDHQNLPSINNLINQPQQQNAQGNSYNNAQSNPQFLAATIDNHRPQTVSPGTDPATLQQ
QQQQAMPQPPQQQQPSDNQQSQQQYQQQQQPQAQQQQQQPQQQSQQFQQQQHQEQNQNEA
QQQPQQQPRQPGHQYTNSVMRVTKGKYSLGDFDILRTLGTGSFGRVHLVQSKHNQRFYAV
KVLKKAQVVKMKQVEHTNDERRMLADVKHPFLITLWGTFQDSKNLYMVMDFVEGGELFSL
LRKSGRFPNPVAKFYAAEVTLALEYLHSKNIIYRDLKPENLLLDRHGHLKITDFGFAKRV
PDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGYTPFWDSGSPMKIYENI
LKGKVKYPAYVNADAQNLLERLITADLTKRLGNLYGGPADVKNHPWFAEVTWDRLARKDI
DAPYTPPVKAGAGDASQFDRYPEDPEKYGMVGGTDEQVMSTEKR
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgccttcactggggtttctcaagaaaaagcggaccagagagggcaactctgacccttcg
gcctcaagtccaaccagcccagtcactcctactacgtccaggtccaagtccatctctaaa
gcttttcacctgcctcgaaacaacagacattccacctcagccccgactgcccagccaacc
aacgcccagcaacaatcgcagcaacagcccgaacatcaacatcaggaaggcgccgcgcct
caatccaatcagcctcctgcgcaaaaccaacaaacggcaggtgcctccgacggccagcaa
gaccacgatatggatacagtcaagcttcacaagcccgagtacgggacgaattccatgagc
ccacacgatcatcaaaaccttccaagcatcaataatcttatcaaccagcctcagcagcaa
aatgcccagggcaattcctataacaacgctcagagcaacccgcagttcttagctgcgaca
atagataaccatcgtccacaaactgtcagccctggaactgatcccgcaaccctccagcag
caacaacagcaggccatgccacagcctcctcagcaacagcagccttctgacaaccagcag
tctcagcaacaataccaacaacagcagcaaccgcaggcccagcaacagcaacagcaacct
caacaacagtcgcagcagtttcaacaacagcaacaccaggaacagaaccagaacgaggcg
caacagcagccacaacagcagcctcgtcagcctggtcaccagtataccaattccgtgatg
cgcgtcacgaaaggcaagtactcgctgggtgacttcgatatcttgaggacgcttggaact
ggtagcttcggccgtgtccatctagtccaatcgaagcacaaccagcgtttctatgctgtc
aaggtgctcaagaaggcacaggtggtcaagatgaagcaggtcgagcataccaatgacgaa
cgacgcatgctggctgatgtcaagcaccctttccttatcactctttggggtaccttccag
gactcaaagaacctctacatggtgatggactttgttgaaggtggcgagctgttttctctt
ctgaggaagtctggtcgcttccctaaccctgtagccaaattctacgcggcagaggtcact
ctagccttggaatacctccattctaagaacatcatctaccgtgatctcaagccagaaaac
ttgctactcgatcgacatggccacctcaagattacagatttcggcttcgcgaagcgtgtg
cccgacaagacttggaccctgtgcggtacacctgattacttagcccccgaagtggtctct
aacaagggttacaacaaatctgtggattggtggtcgttgggtattctcatatacgaaatg
ctttgcggttacacgccattctgggacagtggatctccgatgaagatctacgaaaacatt
ctcaagggcaaggtcaaatatcccgcatacgttaacgcagacgcccagaacctcctggag
cgtctgatcacggccgatttgacgaagcgattgggcaacttgtacggaggcccagcagat
gtgaagaaccacccttggtttgccgaagtcacctgggaccgactagccaggaaggacata
gatgctccgtatacgccaccggtcaaagcaggtgctggtgacgccagccagttcgatcgt
taccctgaggaccctgaaaaatatggaatggttggaggaacagatgagcaagtgatgagt
accgagaagcgatga

DBGET integrated database retrieval system