KEGG   Fusarium pseudograminearum: FPSE_00762Help
Entry
FPSE_00762        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00250  Alanine, aspartate and glutamate metabolism
fpu00410  beta-Alanine metabolism
fpu00430  Taurine and hypotaurine metabolism
fpu00650  Butanoate metabolism
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
Module
fpu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FPSE_00762
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FPSE_00762
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FPSE_00762
   00430 Taurine and hypotaurine metabolism
    FPSE_00762
Enzymes [BR:fpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FPSE_00762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 20359382
NCBI-ProteinID: XP_009252157
UniProt: K3VTZ6
LinkDB All DBs
Position
1
AA seq 568 aa AA seqDB search
MSLAQHSESASPVPIIETDDHGNPIKSSNGYFPSKGKSSTLVGDMAHLSVVGGAHRGDDS
DAASVRSNSSRASRKPQMKLASYQDEFTTSVYGSRFAGMDLPRHHMPENEMPRDIAYRMI
KDDLSLDNNPMLNLASFVTTYMEDEAEKLMAESFSKNFIDYEEYPQSADIQNRCVNMIGD
LFHAPPGSSVGTSTVGSSEAIMLGVLAMKRRWKNRRIAEGKSTEHPNIVMSSAVQVCWEK
ATRYFEIDEKLVYCTPDRFVMDPEQAVDLCDENTIGMCAILGTTYTGEYEDIKAINDLLV
ERNLDIPIHVDAASGGFVAPFVVPDLEWDFRCEKVVSINVSGHKYGLVYPGVGWVIWRSP
EFLPQELVFNINYLGADQSSFTLNFSKGASQVIGQYYQLIRLGKRGYRAIMSNLTRTADY
LTETLENLGFVIMSERSGAGLPLVAFRFKTVDEGGDPERHYDEFALAHHLRSRGWVVPAY
TMAPNSGVKMLRVVVREDFTKSRCDQLICDVKLCHGLLKETDQESIKKREEYIKNHIVTM
GRGKHAHPVYKDEQHSLQGKHGKTHAIC
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgctcagcattcagaaagtgcgtcgcccgttcccattattgagacagacgac
cacggaaaccccatcaagtcaagtaacggatacttcccctctaaaggaaaatcttcaacg
ctcgttggcgacatggctcacctctctgttgtcggtggtgctcaccgcggagacgactct
gacgccgcatctgttcgctcaaacagctctcgggcctcacggaagcctcagatgaagctg
gcgagctaccaggatgagttcaccaccagcgtctacggatctcgcttcgcaggcatggat
cttcccaggcatcatatgccggagaatgaaatgccccgcgacattgcctatcgcatgatc
aaggacgatctgagtcttgacaacaaccccatgctcaacttagcttctttcgttacaact
tacatggaagatgaagccgagaagctcatggcagagtccttctccaagaactttatcgat
tatgaagagtaccctcaatcggccgacatccagaaccgatgtgtcaacatgatcggcgat
cttttccacgctcctcccggttcgtcagtcggtacatcaaccgtcggttcctcagaagcc
atcatgctcggtgttctggccatgaagaggcgctggaagaaccgcagaatcgccgagggt
aagagcacagagcatcccaatatcgtcatgtcctctgccgttcaggtctgttgggaaaag
gctactcgctactttgagattgacgagaagctcgtttactgcacgcctgatcggtttgtc
atggatcccgaacaggctgttgatctatgtgacgagaacaccattggtatgtgtgctatt
cttggaacgacctatactggcgagtacgaggatatcaaggccatcaacgatctcctcgtt
gagcgcaaccttgatatccctatccacgtcgatgctgccagtggaggcttcgtggctcct
tttgtggttcctgatctggagtgggatttccgatgtgaaaaggtcgtctctatcaacgtc
tcgggtcacaagtacggtcttgtctatcctggtgttggttgggtcatctggcgatctcct
gagttcctcccccaagaactcgtcttcaacatcaactacctcggtgctgatcaatcttcc
tttaccctcaacttctccaagggtgcatcgcaagtcatcggccaatactaccagcttatc
cgcctcggcaagcgtggttaccgcgctatcatgagcaacctcacccgtaccgcagactac
ctgacagaaaccctagagaacctaggcttcgtcatcatgtcagaacgttcgggcgctggc
ctccccctcgttgctttccgcttcaagaccgtcgatgagggcggcgaccctgaacgtcac
tacgatgagttcgctcttgctcaccacctgcgatctcgaggctgggttgtccctgcttac
accatggctcccaactccggtgtcaagatgctgcgtgttgtcgtccgagaggactttaca
aagagtcgatgtgaccagctcatctgcgatgttaagctgtgccacggtcttctcaaagag
acagaccaggagtcgatcaagaagcgtgaagagtacatcaagaaccacattgttactatg
ggacgtggaaagcacgcccaccccgtatacaaggatgagcaacattctctccagggcaag
catggcaagacacatgctatttgctag

DBGET integrated database retrieval system