KEGG   Fusarium pseudograminearum: FPSE_00991Help
Entry
FPSE_00991        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00500  Starch and sucrose metabolism
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FPSE_00991
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     FPSE_00991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 20359611
NCBI-ProteinID: XP_009252386
UniProt: K3VVX0
LinkDB All DBs
Position
3
AA seq 633 aa AA seqDB search
MYFVSTAFLFGSFALQSVLGRPALQERQSSLDSFIKSESSVAIEQLLCNIGSDGCHSQGV
ASGVVIASPDTDDPDYFFTWTRDAALVFKYVIDRFINQYDTGLQTKIQQYIASQAKLQGV
SNPSGSLSDGSGLGEAKYEVDLSPFTGGWGRPQRDGPALRATAIITYANWLIDNGYTSTA
SDIIWPVVRNDLNYVAQYWNQTGFDLWEEVKGSSFFTTASQYRALTEGAALAKKLGKSGD
NYAAIAPQALCFLQTYWIPSGKYVDSNINVNDGRTGKDANSILTSIHNFDPALSCDTTTF
QPCSDKALANHKAVTDSFRSWNINKGISQGSAVSVGRYIEDVYYNGNPWYLATLAAAEQL
YDALYVWKQKGSITVNDVSLSFFKDLVSGISTGTYASDSATFKSITDAVSKYADGYVSIV
QKYVGDNGALSEQFDKNNGRPLSATDLTWSYAAFLSAADRRAGIVPPSWASGAAAVPQQC
GTQTVAGSYSLATATSFPPSQTPKGGAPSPTGTQPSTSPTTSPTSCPIATSVAVTFVETV
TTNFGETIKIVGNIPALGNWDTSKAVALSASDYTSSNPVWKATISLTAGQDIQYKYINVK
KDGSVTWEKDPNRTYSVPKTCSTKATKTDKWQS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtacttcgtttccaccgccttcctcttcggctccttcgctttacagagtgtcctgggc
cgaccagctctacaagaacgacaatcttctcttgattcctttatcaagtccgagagctcg
gttgctatcgagcaactcctttgcaatatcggttctgatggttgtcactcccagggtgtt
gcttctggtgttgttattgcatctccagataccgatgaccccgactacttcttcacttgg
actagagatgctgctcttgtcttcaagtatgttatcgatagattcatcaaccagtacgac
actggcttgcagacaaagatccagcaatacattgcatctcaagccaagcttcagggagtc
tctaacccttccggatccctctccgacggctctggtctaggagaagctaaatacgaagtt
gaccttagcccctttactggtggttggggccggccccagcgagatggtccagctctgcga
gccactgctataatcacttatgctaactggttgatcgataatggatacacttctaccgcc
tctgacattatttggcctgttgtccgtaacgatcttaactatgtagctcaatactggaac
caaaccggctttgacttgtgggaagaggtcaagggaagttcattctttacaaccgcttct
caataccgagctcttaccgaaggcgccgctctggccaagaagctgggcaagtcaggagac
aactatgccgctatcgcaccccaggccctttgcttcttgcaaacttactggatcccctct
ggcaaatatgttgattccaacattaatgtcaacgatggacgtactggaaaggacgcaaac
agtattctcacgtccatccacaacttcgaccctgctctgagctgcgataccaccacgttc
caaccctgcagtgacaaggcccttgccaaccacaaggctgtcactgattctttccgctca
tggaacatcaacaagggtatctcccagggaagcgccgtatctgttggaagatacatcgaa
gatgtctactacaacggtaacccctggtaccttgccaccctcgccgcggccgaacaactc
tacgatgcgctttacgtctggaagcaaaagggatccatcaccgtcaacgacgtttctctc
tcgttcttcaaggatctcgtctctggaatctccactggcacttacgctagcgactctgct
accttcaagagcatcaccgatgccgtctccaagtatgctgatggatatgtgagcatcgtc
cagaagtatgtcggtgacaacggcgccttgtcagagcagtttgacaagaacaacggacgt
cccctttctgccacggacctgacctggtcatacgctgctttcctctctgctgctgaccgc
cgagctggtattgtccctccttcttgggcgagtggcgcagctgctgttcctcagcagtgt
ggaacccagaccgtcgctggctcatactcgctcgccactgctacctcgttcccaccatcg
cagacacccaagggcggtgctccatcccccacaggcacccagccttcgacttcacctact
acttcacctacttcttgtcctatcgcaacttcagttgctgtcacctttgttgagacggtt
accaccaacttcggcgagaccatcaagattgttggcaacatccctgcccttggtaactgg
gacacttcgaaggctgttgctctgagcgcctctgactacacctcttccaaccctgtgtgg
aaggcaaccatctctctcactgcaggacaagatatccagtacaagtacatcaacgttaag
aaggatggttcagtcacctgggagaaggaccccaaccgcacctacagtgttcccaagaca
tgctctacaaaggccacgaagacggacaagtggcagtcttaa

DBGET integrated database retrieval system