KEGG   Fusarium pseudograminearum: FPSE_01223Help
Entry
FPSE_01223        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00020  Citrate cycle (TCA cycle)
fpu00480  Glutathione metabolism
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
fpu01130  Biosynthesis of antibiotics
fpu01200  Carbon metabolism
fpu01210  2-Oxocarboxylic acid metabolism
fpu01230  Biosynthesis of amino acids
fpu04146  Peroxisome
Module
fpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FPSE_01223
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FPSE_01223
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    FPSE_01223
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     FPSE_01223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 20359843
NCBI-ProteinID: XP_009252618
UniProt: K3VT86
LinkDB All DBs
Position
1
AA seq 463 aa AA seqDB search
MPVAALASSVPRSLFSSSLRRVAYTSTTIRPVRASFGAIQTISPFAVRTMASSTQKIKVK
NPVVELDGDEMTRIIWQVIKDKFIHPYLDIDLKYYDLGLEYRDETNDQVTIDAAEAIKKY
SVGVKCATITPDEARVEEFKLKKMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGWKKP
IIIGRHAFGDQYRAKDAVLPGPGKLSMVYTPEGGQPEEIEVFQFKEGGGVAQTQYNTDES
ITGFAHASFKLAIDKELPLYMSTKNTILKKYDGRFKDIFQEIYETTYKKEFEAKKIWYEH
RLIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAA
HGTVTRHYREHQKGNETSTNPIASIFAWTRGLIQRGKLDDTPDVVAFAEGLEQACIDTVD
IDGIMTKDLALATGKSERKDYATTNEYLDAVERRLKKTLKEKL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgctgctctcgcctcttccgtcccgcgatctctattctcctcttcgctgcgc
cgtgtcgcttatacttccaccactatccgccctgttcgcgcttcattcggtgctatccaa
accatctccccattcgcagtccgcacaatggcttcctctactcagaagatcaaggtcaag
aaccccgtcgtcgagctcgacggtgatgagatgacccgcatcatctggcaggtcatcaag
gacaagttcatccacccctacctcgacatcgacctcaagtactatgatctcggtcttgag
taccgtgacgagaccaatgaccaggtcaccattgatgctgccgaggccatcaagaagtac
tctgtcggtgtcaagtgtgctaccatcactcccgatgaggctcgtgttgaggagttcaag
ctgaagaagatgtggctttctcccaacggcaccatccgaaacgctcttggcggtaccgtc
ttccgtgagcccattgttatcccccgtatcccccgtctggttcctggctggaagaagccc
atcatcattggccgtcacgcctttggtgaccagtaccgcgccaaggatgctgtccttccc
ggtcccggtaagctctccatggtctacacccccgagggtggccagcctgaggagattgag
gtcttccagttcaaggagggtggtggcgttgcccagactcagtacaacaccgacgagtcc
atcactggattcgctcacgcttctttcaagctcgccattgacaaggagctccctctctac
atgagcaccaagaacaccatcctcaagaagtacgatggtcgcttcaaggacatcttccag
gagatctacgaaaccacctacaagaaggagttcgaggccaagaagatctggtacgagcac
cgtctcatcgacgacatggtcgctcagatgatcaagagctccggtggttacatcatggct
ctcaagaactacgatggtgatgtccagtccgacattgtcgcccagggcttcggctctctc
ggtctcatgacctctgtcctcatcacccccgatggcaagaccttcgagtctgaggctgcc
cacggtaccgtcactcgccactaccgtgagcaccagaagggtaacgagacctccaccaac
cccatcgcttccatcttcgcctggacccgtggtcttatccagcgtggtaagctcgacgac
acccccgatgtcgttgccttcgccgagggccttgagcaggcttgcattgacaccgtcgac
attgacggtatcatgaccaaggatcttgcccttgccactggcaagtctgagcgcaaggac
tatgccaccaccaacgagtaccttgatgctgtcgagcgccgcctcaagaagactctcaag
gagaagctgtaa

DBGET integrated database retrieval system