KEGG   Fusarium pseudograminearum: FPSE_02165Help
Entry
FPSE_02165        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
Organism
fpu  Fusarium pseudograminearum
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc FAD_binding_3 Pyr_redox_3 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 20360784
NCBI-ProteinID: XP_009253559
UniProt: K3VQB3
LinkDB All DBs
Position
2
AA seq 387 aa AA seqDB search
MPRLLFPTFKSLVTKPLRKTPTTIHRSYYSTMMRAARYYGKEDIRVEQVPQPSVKAGQVK
VAPAFVGICGTDLHEYLGGPNFCPTTPHPITKESIPVTLGHEFSGIITEVGPDVEGFEVG
QPCAIQPTLFCGHCAACHNHAENVCHSGGFIGLSGSGGGLSESVCVNATHVHPLPRDLPL
EIGALVEPLSVSWHAMTAAPEINPSSKVVILGGGPIGLAMILCLKAKGVSEIILSEVATS
RQNFARELGATRVVNPIEENLNEIVLGLTDGKGADVVFDCAGVPMSIKSACEVVRPKGTV
VNLAIWEKEIPFNPNWITMKESSYKSVLGYAHADFQAVIANLASGAIKPSQMITRKIKLE
NIVEDGIKALIHDKNNQVKVLVDMSDK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgccaagactgctatttccaacattcaaatccctcgttacaaaacccctccgcaaaaca
cccacaaccatccatcggtcgtattacagcaccatgatgcgagcagcgagatactatggt
aaagaagacattcgtgtcgagcaagttcctcagccttctgtcaaagcaggacaagtcaag
gttgccccagcgtttgtcggcatttgcggaacagatttgcacgagtatttaggaggcccc
aatttctgtccaacaacacctcatcccatcaccaaggaatccattcctgtcactctcgga
cacgaattctctggcatcatcaccgaggtcggtcctgatgtcgaaggcttcgaagttggt
cagccttgtgctattcagccaaccctattctgtggtcactgcgcagcttgtcacaaccac
gccgagaatgtctgtcacagtggtggcttcataggcttgagtgggagtggcggaggatta
agcgaatctgtttgcgtcaatgccacacatgttcatcctcttcctcgagatctgcctcta
gagattggagcgcttgttgagcctctctctgtttcgtggcatgcgatgactgcggcacca
gagatcaaccccagttccaaagttgtgatcctcggaggtggcccaattggcttggccatg
attctatgtctcaaagccaagggtgtcagcgaaatcattctttcagaggtcgctacctca
cgacagaactttgctagagagcttggtgccacgcgcgttgtgaatccgatcgaggagaac
ctcaatgaaatcgtgctcggtttgactgatggcaagggtgctgatgttgtgtttgactgc
gccggtgtaccgatgagtattaagagcgcatgtgaagtcgtcaggcctaagggtacagtg
gttaatctagccatctgggagaaggagattcctttcaacccaaactggattacgatgaag
gaaagctcatacaagtctgttctgggatacgcccatgcagacttccaggccgtcatcgca
aaccttgcttcaggtgctataaagcctagccagatgatcacaagaaagataaagctcgag
aatatcgtggaagatggaataaaggcgctgattcatgataaaaataaccaagtaaaggtg
ttggtggatatgagcgataaatga

DBGET integrated database retrieval system