KEGG   Fusarium pseudograminearum: FPSE_02184Help
Entry
FPSE_02184        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
Organism
fpu  Fusarium pseudograminearum
SSDB OrthologParalogGFIT
Motif
Pfam: RTA1
Motif
Other DBs
NCBI-GeneID: 20360803
NCBI-ProteinID: XP_009253578
UniProt: K3UY36
LinkDB All DBs
Position
2
AA seq 298 aa AA seqDB search
MAQETPICVHISKECPIEYTVYGYRPSLWVNILLVSLFTIALFANIWLGIRFRIRAYAIV
LALASLAQIVGYGARIGMYFLPFNAIPFQAQVCCLIIGPAFNSAAVYLMLKYIVTLFGPE
WSLLKPKLYTIIFIGADVVSLVLQAAGGGIAATTAIGDDDMLNLGNNIMMAGIAFQVVTL
SVFALLATAFCIRRVRAVKFNPLNGNALKTWQGPRFRWFICGLFTAFLTIYVRCVYRIAE
MRGGWGNKLMKEQIPFILLEGLMILIATLSQTILHPGPFFPAFTNKECRLDILVDVMQ
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagaaacacccatatgcgtgcacatctctaaagagtgcccgattgaatacact
gtgtatggttatcgcccgagcctttgggtcaacattctactggtatcgcttttcaccatc
gcccttttcgccaacatctggctcggaatccgcttccgcatccgtgcctatgccatcgtc
ctcgcgttggcctccttggctcaaatcgtaggctacggcgcaaggatcggaatgtacttc
ctacccttcaacgccattcccttccaagcccaggtctgctgcctcatcattggcccagct
ttcaacagcgcggctgtgtatctcatgctcaaatacatcgttacactattcggccccgag
tggtccctgctgaagccgaagctgtacactatcatcttcatcggcgcggacgttgtgtca
ttagtcctgcaggctgcagggggtggaatcgcagcgaccacggctattggcgacgatgat
atgctgaatctcggaaacaacatcatgatggctggcatcgcctttcaggtggttacctta
tctgtgtttgcattgctggccacagcattctgcattaggcgtgtgcgagctgtcaagttt
aaccccctgaatggcaatgcactcaaaacctggcaaggtccacggttccgttggtttatc
tgtggtctgtttacagcatttttgacgatctacgttcgatgtgtatatcgaatcgctgag
atgagaggtggatggggtaacaaactaatgaaggaacaaattcctttcattcttcttgag
ggacttatgattcttattgcaacattgtcacagactatcctgcacccggggcctttcttc
cctgctttcacgaataaggagtgtcggcttgatatactagtggatgtcatgcagtag

DBGET integrated database retrieval system