KEGG   Fusarium pseudograminearum: FPSE_02768Help
Entry
FPSE_02768        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00250  Alanine, aspartate and glutamate metabolism
fpu00410  beta-Alanine metabolism
fpu00430  Taurine and hypotaurine metabolism
fpu00650  Butanoate metabolism
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
Module
fpu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fpu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    FPSE_02768
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FPSE_02768
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FPSE_02768
   00430 Taurine and hypotaurine metabolism
    FPSE_02768
Enzymes [BR:fpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FPSE_02768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 20361387
NCBI-ProteinID: XP_009254162
UniProt: K3VQ49
LinkDB All DBs
Position
4
AA seq 508 aa AA seqDB search
MTVTNGRNGNPSMTTTTLHRAEEVDDLIDAVRGLIVPYIKAADDAAADRATGDITPDSSG
VKDNVLVDFQKPEQLAQRLKFSLPNQGQGKDGLLDIIQQILKNSVNTWDQGFLDKLYAST
NAVGVVSDMVLSVLNTNLHVFQVSPALTIIEKTTAKTLAHLFGFTGARAGGISCQGGSSS
NLTSLVVARNTLFPECRTEGNGKHDFVVFTSAHGHYSVEKSAMICGMGSNSVWPVPVNEV
GCMKPDALRELVLKAKTEGKTPLYVNSTAGTTVMGSYEPFEEISKICKEFGLWMHIDASW
GGPAIFSSKHKHKLNGAHLADSLTVNPHKMMNVPVTCSFLLGPDMGIFNKANSTAAGYLF
HTIDGGDFWDLADLTLQCGRRGDSLKLALAWIYYGAAGFEKKIDHAFEQAAYLANLIKQS
DNFVLVSQDPPPCLQICFYNAPGGTLSEDKEENTLRTKTMVEKMILRGYMVDYAPGPKGS
FFRVVVNCQTLAGTVEGLVKGLEEVGRE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaccaacggccgcaatgggaacccctccatgaccacaaccaccctccatagg
gctgaagaagtagacgatcttatcgacgccgttcgtggtctcatcgtaccttacattaag
gccgctgatgacgctgccgcagaccgtgctactggagatattacacccgactcatctggt
gtaaaggacaatgtcttggtagactttcaaaaacctgagcagctcgcccagcgtctcaaa
ttctctttgccgaaccaaggacaaggcaaggacggcctattagatattattcaacaaatc
ctgaagaacagcgtcaatacttgggatcaagggtttcttgacaagctctatgcaagcaca
aatgcggttggtgtagtatcagatatggtcctgtccgtcctcaataccaatctgcatgtt
ttccaggtctcccctgctctcaccattattgagaagaccacagcaaagacgctagctcat
ttgttcggcttcaccggagcacgagccggtggtatctcttgccagggtggaagttcttca
aacctgacttctcttgtagttgctcgcaacactttgttcccagagtgtagaaccgagggc
aacggcaagcatgattttgtggtttttacaagtgcgcacggtcattactcggttgaaaag
agtgccatgatctgcggtatgggttcaaacagcgtttggcctgttcctgtaaatgaggtc
gggtgtatgaagcctgatgctctaagagagttggttctcaaggcgaagactgagggcaag
acccccctttatgtcaactccacagcaggaaccactgtcatgggttcatatgagcctttc
gaagagatctccaagatttgcaaggagtttggtctctggatgcatatcgatgctagctgg
ggtggtccagccatcttctcctcaaagcacaagcataagctcaacggggcccatcttgct
gactcactgacggtaaaccctcataagatgatgaacgtccctgtcacctgctcgttcctc
ctaggtcccgacatgggtatcttcaacaaggctaacagcaccgctgctggctacttgttc
cacaccatcgatggtggcgacttctgggatcttgcagacctgacactgcagtgtggccgt
cgcggtgacagtctcaagctcgcattggcttggatctactacggtgcggccggtttcgag
aagaaaatcgatcacgcattcgagcaggctgcctacctagccaacctcatcaagcaaagc
gacaactttgttcttgtgtcgcaagatcctcctccctgtctgcagatatgcttttacaac
gcccctggaggaaccctgtccgaggacaaggaggagaatacactccgaactaagacgatg
gttgagaagatgattcttcgaggatatatggttgattatgcacccggacccaagggcagt
ttctttcgggttgtagtcaactgccagaccttggcaggaactgtcgaaggcctggtcaag
ggtctcgaggaagttggacgcgagtag

DBGET integrated database retrieval system