KEGG   Fusarium pseudograminearum: FPSE_04172Help
Entry
FPSE_04172        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00020  Citrate cycle (TCA cycle)
fpu00190  Oxidative phosphorylation
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
fpu01130  Biosynthesis of antibiotics
fpu01200  Carbon metabolism
Module
fpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fpu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FPSE_04172
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FPSE_04172
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FPSE_04172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DUF600 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 20362790
NCBI-ProteinID: XP_009255565
UniProt: K3UT42
LinkDB All DBs
Position
4
AA seq 649 aa AA seqDB search
MASSMAMRKLALGPAFTRAARFPTRAFSTTRPVSRVITGNGPLRAKEASPFVSNKYAVID
HEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDW
RWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSKE
FGKGGQAYRCCAAADRTGHALLHTLYGQSLRHKTNYFIEYFALDLIMQDGECRGVLAYNQ
EDGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTG
IYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGA
EKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTG
EVLTVDEKGEDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFNPG
DALKPTAADAASDHIETLDKVRTADGPKSTAEIRLAMQKAMQTEVSVFRTQESLDEGVRK
MKEIDGMYSQVGMKDRSMIWNSDLVETLELRNLLTCAIQTAESAANRKESRGAHAREDFP
DRDDENWMKHTLSFQKQPHGKVDLSYRKVIGTTLDEAECKPVPPFKRTY
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctatggcaatgaggaagttggccctcgggcctgccttcacaagggctgcc
aggttccctacccgagctttctctacaacccgacctgtttcccgagttattactggaaac
ggtcctctacgagccaaggaggcctctcctttcgtgagcaacaaatacgccgtcatcgac
cacgagtatgatgctctcgttgttggtgctggtggtgccggtctgcgagctgccttcggt
ctcgctgaggctggcttcaacactgcctgtatctccaagctcttccctacccgatctcac
actgtcgccgctcagggtggtatcaacgctgctctaggtaacatgcacgaggacgactgg
cgatggcacatgtacgataccgtcaagggttccgactggctgggtgaccaggacgctatt
cactacatgacccgagaggctcccgcttccattatcgagcttgagaactacggctgcccc
ttctcgcgaactgaggatggcaagatttaccaacgagctttcggtggtcagtccaaggag
tttggaaagggtggccaggcctaccgatgctgtgctgccgctgaccgaaccggccacgcc
cttcttcacactctctacggccagtctcttcgccacaagaccaactacttcatcgagtac
ttcgccctcgacctgattatgcaggatggcgagtgccgcggtgtcctcgcctacaaccag
gaggacggcactctgcaccgattcctcgccaaccacaccgttctcgccactggtggttac
ggccgagcttacttctcctgcacatccgcccacacctgtaccggtgatggtatggccatg
gttgcccgtgctggtctccccaaccaggatctcgagttcgtccagttccaccctactggt
atctacggagccggttgcctgatcactgagggttctcgtggtgagggtggttacctcctc
aactccgagggtgagcgattcatggagcgatatgcccctaccgccaaggatcttgcttct
cgtgatgtcgtttcccgatccatgaccatggaaatccgtgagggtcgtggtgttggtgct
gagaaggatcacatctacctccagctcagccatctccccgctgagattcttgctgagcgt
ctgcccggtatctctgagactgctggtattttcgctggtgtcgatgtccgcaagcagccc
attcctgttcttcccaccgtccactacaacatgggtggtattcctacacgatacactggt
gaggttcttaccgtcgatgagaagggtgaggacaaggttgttcctggtctgtacgcttgt
ggtgaggccgcttgtgtgtctgtccacggtgctaaccgtctgggtgccaactctcttctg
gatcttgttgtctttggtcgtgccgtttcgcacaccattcgtgacaagtttaaccccggt
gatgctctgaagcctaccgctgctgacgctgcctctgaccacatcgagaccctcgacaag
gtccgaactgccgacggccccaagagcactgccgagatccgacttgccatgcagaaggcc
atgcagaccgaggtcagcgtgttccgaacccaggagagtctggacgagggtgtccgcaag
atgaaggagatcgacggcatgtacagccaggttggcatgaaggaccgcagcatgatctgg
aactctgatcttgttgagacccttgagctccgaaacctgttgacttgcgctatccaaacc
gccgagtctgccgccaaccgaaaggagtctcgtggtgctcacgcccgcgaggacttcccc
gaccgagatgacgagaactggatgaagcacactctctctttccagaagcagcctcacggc
aaggtcgacctgtcctaccgaaaggtcataggcaccaccttggacgaggccgagtgcaag
cccgtgccacctttcaagcgtacatactaa

DBGET integrated database retrieval system