KEGG   Fusarium pseudograminearum: FPSE_04405Help
Entry
FPSE_04405        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00010  Glycolysis / Gluconeogenesis
fpu00051  Fructose and mannose metabolism
fpu00052  Galactose metabolism
fpu00500  Starch and sucrose metabolism
fpu00520  Amino sugar and nucleotide sugar metabolism
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
fpu01130  Biosynthesis of antibiotics
fpu01200  Carbon metabolism
Module
fpu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fpu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FPSE_04405
   00051 Fructose and mannose metabolism
    FPSE_04405
   00052 Galactose metabolism
    FPSE_04405
   00500 Starch and sucrose metabolism
    FPSE_04405
   00520 Amino sugar and nucleotide sugar metabolism
    FPSE_04405
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FPSE_04405
Enzymes [BR:fpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     FPSE_04405
Membrane trafficking [BR:fpu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    FPSE_04405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 20363023
NCBI-ProteinID: XP_009255798
UniProt: K3USI6
LinkDB All DBs
Position
1
AA seq 492 aa AA seqDB search
MVGLGPRRPPSRKGSMADVPKDLAEEINKLENLFTVQPSKLKEITNHFVSELAKGLSVEG
GSIPMNPTWVMSYPDGYETGTYLALDMGGTNLRVCQITLTDEKSEFDIIQSKYRMPEELK
SGTSEELWEYIAECLYQFLETHHGDCTKLEKIPLGFTFSYPATQNYIDEGILQRWTKGFD
IDGVEGQNIVPMFEEALKTRGVPIKLAAIINDTTGTLIASAYTDTAMKIGCIFGTGCNAA
YMEDCGSIPKIADLNLPADLPMAINCEWGAFDNEHKVLPRTPYDVIIDKESPRPGQQAFE
KMIAGLYLGEIFRLILVDLHDNKSIHIFENQDIALLRKPYSLDASFLSAIEEDPWENLSE
TSDLFSKKLNLKCTQPELELIRRTAELIGTRAARLSACGVAAICKKKNYQSCHVGADGSV
FNKYPHFKERGAKALREILDWPEKTNKKEEDPIEVLTAEDGSGVGAALIAALTLKRINEG
NMAGILHPENFK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggttggtcttggtcctcgtcgccctccctcccgaaagggatccatggccgatgtcccc
aaggacctcgctgaagagatcaacaagctcgagaatctcttcacggtacagcccagcaag
cttaaggagatcaccaaccatttcgtttctgaactcgccaagggtctcagcgttgagggt
ggtagcattcctatgaatcctacctgggtcatgtcataccccgatggctatgaaaccggc
acctacctggccctcgacatgggcggcaccaacctgagagtgtgccagatcacacttact
gacgagaagtccgagttcgacatcatccagtccaagtaccgcatgcctgaggagctcaag
tctggcacctctgaggagctttgggagtacattgccgaatgtctctaccagttccttgag
acacaccacggagactgcacaaagttggagaagatccctctgggtttcacattctcgtac
cccgccacccagaactacatcgatgagggtatccttcagcgatggaccaagggcttcgac
attgacggtgtcgagggccagaacattgttcccatgttcgaggaggccttgaagactcgg
ggcgttcctatcaagcttgccgctatcatcaatgatactaccggcacattgattgcctcc
gcctacaccgatactgccatgaaaattggttgcattttcggcacaggttgcaacgccgca
tacatggaagactgcggctcaatccccaagattgctgacctgaacctccctgctgatctg
cctatggccatcaactgcgagtggggagctttcgacaatgagcataaggtcctcccccga
accccctacgacgtcatcattgacaaggagtcccctcgccctggacagcaggcttttgag
aagatgattgctggtctgtaccttggcgagatcttccgactcattctcgtcgacctccac
gacaacaagtctatccatatctttgagaaccaagatattgctctcctccgcaagccttat
tctctggatgcctccttcctgtctgctatcgaggaggacccttgggagaacctgtccgag
acaagcgacctcttcagcaagaagctgaacttgaagtgcacacagcctgagcttgagctt
atccgcagaaccgccgagctcatcggcacacgagctgcccgcctctcggcctgtggcgtt
gctgctatctgcaagaagaagaactaccaatcttgccacgtcggtgctgacggttccgtg
ttcaacaagtacccccacttcaaggagcgtggtgccaaagctctgcgggagattctcgac
tggcccgagaagaccaacaagaaggaagaggaccccattgaagtcctgactgccgaggac
ggtagcggtgtcggtgccgccctgattgccgccctgacgcttaagcgcatcaatgagggc
aacatggcgggtatccttcaccccgagaacttcaaataa

DBGET integrated database retrieval system