KEGG   Fusarium pseudograminearum: FPSE_04697Help
Entry
FPSE_04697        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01078  acid phosphatase [EC:3.1.3.2]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00730  Thiamine metabolism
fpu00740  Riboflavin metabolism
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FPSE_04697
   00740 Riboflavin metabolism
    FPSE_04697
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     FPSE_04697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 20363315
NCBI-ProteinID: XP_009256090
UniProt: K3VKT9
LinkDB All DBs
Position
2
AA seq 485 aa AA seqDB search
MKGPIIAAAVLGSYCQVSHAQSGSSIDPVQPVLLPDTAAAKNPLSHLGGNGPWHIGADIT
GISSDVPEGCEVDQAAYVSRHGSRYPDTGAHNGWLEMQSKFQNSDYTATGPLEFLHRWKS
PLTNPEIQIAQLSKTGYKELFDMGYTLRTRYPDLYREGEDFVVWANNYTRVIQTAQLFLH
GFLGTNSSLGTVVAVTGKGMPAHLGDTLAPSDMCPTFVDDSSKQTDAWRSKWLPAFKKRL
SQYIEGDLELEDGQWGDFPYICGFESQITGRLSSFCNTFNQKEMEQYEYQQDLRYYYGVG
PATKVASKMMVPFLDALVQRFVAGPDATGTNFEGKQFKLPKILMSFLNDGQLNELAVATG
VYDNQKKLPVDRIPEDRLWRNSEISPMRGTIAFERLTCATKKGRPGQKYMRILINDVVYP
VPSCKDGPGRSCSLAKYAKITKDRLKKNGNFAKLCNATDPATPSKVLGASFFTNLAQPHL
KPVKP
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcccaattatcgccgccgctgtgctcggcagttactgtcaggtcagccatgct
caatcaggcagctcaattgatccagtgcagcccgtcctgcttccggacacagctgccgcg
aagaaccctctatcacatcttggcggtaatggaccgtggcatataggtgccgatattacc
ggtatttcttctgatgtgccagagggctgcgaggtcgaccaagctgcctacgtatcacgt
catggatccaggtaccctgataccggagctcacaatgggtggcttgagatgcagagcaag
ttccaaaactccgactatactgcgactggacccctggagttcctccaccggtggaagagc
cctctaaccaatcctgagatccagattgctcagctcagcaagactgggtacaaggagctt
tttgacatgggatatacccttcgtactagatatcctgatctttaccgcgaaggtgaagac
tttgtggtctgggccaacaattacacgcgtgttattcagaccgctcaactcttcctccat
ggtttcttggggacaaactcttcactgggcacggttgttgccgttactggcaagggtatg
cctgctcatcttggcgacactctggccccctccgacatgtgcccaacgttcgtggacgac
agcagcaagcagacagacgcctggcgctccaagtggctacccgccttcaagaagcgattg
tcccagtacatcgagggtgatctagagcttgaagatgggcaatggggggacttcccttac
atctgcggattcgagtcgcaaatcacgggtcgcctttcatccttttgcaataccttcaat
cagaaggagatggagcaatacgaatatcagcaagacctgaggtactactacggtgtcggt
ccagcaaccaaggtggcctcaaagatgatggtccccttccttgatgcgttagtgcagcgt
tttgttgccggacccgacgctaccggtaccaacttcgagggcaaacagtttaaacttccc
aagattttgatgagctttttgaacgacggccaattgaacgaacttgctgtcgccaccggt
gtatacgacaaccaaaagaagctgcccgttgaccgcatccctgaggatcgtctctggcgc
aactcagagatctctcccatgcgaggtaccatcgcatttgagcgtcttacctgcgccacc
aagaagggacgtcctggacagaagtacatgcgaatcctcatcaacgatgtggtctacccg
gtgccatcttgcaaagatggaccaggaaggtcgtgctcgctggcaaagtatgccaagatt
accaaggatcggctcaagaagaacggtaactttgcgaagctttgtaacgcgacagatcct
gctacgccttccaaggttcttggagctagcttttttacaaacttggctcaacctcacctg
aagcctgttaagccataa

DBGET integrated database retrieval system