KEGG   Fusarium pseudograminearum: FPSE_04830Help
Entry
FPSE_04830        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00020  Citrate cycle (TCA cycle)
fpu00310  Lysine degradation
fpu00380  Tryptophan metabolism
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
fpu01130  Biosynthesis of antibiotics
fpu01200  Carbon metabolism
Module
fpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FPSE_04830
  09105 Amino acid metabolism
   00310 Lysine degradation
    FPSE_04830
   00380 Tryptophan metabolism
    FPSE_04830
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FPSE_04830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 20363448
NCBI-ProteinID: XP_009256223
UniProt: K3W0Z5
LinkDB All DBs
Position
2
AA seq 1051 aa AA seqDB search
MLRNSLCRASSQLLRGARCSAASSTASISTLSARTSSWKLAASRRPLAVGARRTYATSAT
SSPPDPNDNFLSGSTASYIDEMYMQWRQDPESVHVSWQIYFKNMEGGEMPISQAFQPPPN
LVPGMTGGVPRLSGNLAMEDGSDVTNHLKVQLLVRAYQSRGHHTAKIDPLGIRGTNDAKG
FANIKPKELTLEHYGFTEKDMDTEYTLGPGILPRFKRDGREKMTLREIVDACERIYCGSF
GVEFIHIPDRDKCDWLRERLEVPNPFKYSVDEKRRVLDRLIWSSSFESFLATKYPNDKRF
GLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTSG
GEDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEK
THRTAMSVLLHGDAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARST
AYCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKYGHNETDQ
PSFTQPLMYKRINAKEPQIDIYVNKLIEEGSFSKADVEEHKQWVWGMLEESFTKSKDYTP
TSKEWTTSAWNGFKSPKELATEVLATNETNVKSTTLEHIGNAIGSVPEGFQVHRNLKRIL
SNRTKSVVEGKNIDFPTAEALAFGTLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDT
HTPLQNLSQDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIID
QFIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPREFPTGEKLVRQH
QDCNMQIAYFTSPANLFHALRRQMHRQYRKPLIIFFSKSLLRHPLARSDIEAFTGENAGF
QWIIPDPEHETGAIKSPDQIERVVLCTGQVWAALHKYRADNNIDNVAFTRIEQLNPFPWQ
QLKENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTEHHTRKHVMYAGRNPSAS
VATGLKNVHTKEEKDFLEMAFTVKQDKLKGE
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggaattcgctctgtagagctagctcgcagctccttcgcggtgctcgatgctct
gctgcctcttctaccgcctctatctcgaccctctcggcccgcacctcatcatggaagctc
gctgcttcccgtcgccctctggccgtcggtgctcgtcgcacctatgcgaccagcgcgacc
tcgtcacctcccgaccccaacgataacttcctctccggaagcaccgccagctacatcgat
gagatgtacatgcagtggagacaagatcccgagagcgtccacgtctcttggcagatctac
ttcaagaacatggagggcggcgagatgcccatctctcaggctttccagcctcctcctaac
ctggttcctggcatgactggcggcgtccctcgtctttctggcaacttggccatggaggac
ggttccgatgtcaccaaccatctcaaggtccagcttctcgtccgcgcttaccagtctcgc
ggccaccacaccgccaagattgaccctctcggtatccgaggcaccaatgacgccaagggt
ttcgccaacatcaagcctaaggaattgactctcgagcactacggattcactgagaaggat
atggacactgagtacactctcggtcctggtatcttgcctcgcttcaagcgtgatggccgt
gagaagatgactctccgcgagattgtcgatgcttgcgagagaatctactgtggttctttc
ggtgttgagttcattcacattcctgaccgtgacaagtgcgactggctccgtgagcgtctc
gaggttcccaaccctttcaagtactctgtcgatgagaagcgccgtgttctcgaccgtctt
atctggagttccagctttgagtctttcctggccaccaagtaccccaacgataagcgattc
ggtctcgagggttgcgaaacccttgttcccggtatgaaggctcttattgaccgcagtgtt
gactacggtgtcaaggatatcgttatcggtatgccccatcgtggtcgtctcaacgtcctc
tccaacgtcgtccgaaagcccaacgagtcaatcttcagcgagtttgctggtacatctggt
ggtgaggatgagggctctggtgacgtcaagtaccatcttggtatgaactttgagcgcccc
acgccttctggcaagcgcgtgcagctttctctggtcgccaacccttcgcatctcgaagcc
gaggatcccgtcgtcctgggcaagacccgtgctatccagcactacaacaacgacgagaag
actcaccgtactgccatgagtgttctccttcacggtgatgctgcctttgctgctcagggt
atcgtctacgagtgtctcggcttccactctctccctgccttctccacaggaggtaccatc
cacctggttgtcaacaaccagattggtttcacaaccgaccctcgtttcgcccgatccacc
gcctactgtaccgatattgccaaggccatcgacgcccccgtcttccacgttaacgccgac
gatgtcgaggccgtcaactttgtctgccagctcgctgccgattggcgcgccgagttccag
cacgatgttgtcatcgatctcaactgttaccgaaagtacggtcacaacgagaccgatcag
ccttcattcacccagcctctcatgtacaagcgcatcaacgccaaggagcctcaaattgac
atctacgtcaacaagcttatcgaggagggttctttctccaaggccgatgtcgaggagcac
aagcagtgggtctggggtatgctcgaggagagcttcaccaagtccaaggattacacaccc
acctccaaggagtggaccacctccgcctggaacggcttcaagtcccccaaggagctggct
actgaggttcttgccaccaacgagaccaacgtcaagagcactaccctcgagcacattggt
aacgctattggaagcgttcccgagggcttccaagttcaccgcaacctgaagcgtatccta
agcaaccgaaccaagtctgttgttgagggtaagaacatcgactttcctaccgctgaggcc
ctggccttcggtactctcgtaactgagggttaccacgtccgtgtctccggtcaggatgtt
gagcgtggtactttctctcagcgccacgctgtcttccacgaccaggagactgaggatacc
cacactcccctccagaacttgagccaggaccagggcaagtttgtcatctccaactcttct
ctgagtgagtttggtgcccttggtttcgagtacggttactctctgtcatctccccatgct
cttgtcatgtgggaggcccaattcggtgactttgccaacaacgcccaatgtatcatcgac
cagttcatcgcctctggtgaagttaagtggatgcagcgaacaggtcttgtcatgtctctg
ccccacggttacgatggtcagggccctgagcactcctctggacgtcttgagcgatacctc
cagctcagtaacgaggacccccgagagttccccactggtgagaagctcgtccgtcaacat
caggactgcaacatgcagatcgcctacttcacctctcccgccaacctgttccacgccctc
cgccgacagatgcaccgccagtaccgcaagccccttatcatcttcttctccaagtctctc
ctccgtcaccctcttgctcgcagcgacattgaggctttcactggcgagaacgccggattc
cagtggatcatccctgaccctgagcatgagactggtgctatcaagtctcctgaccagatt
gagcgtgttgttctctgcaccggtcaggtttgggctgccctccacaagtaccgagctgac
aacaacatcgacaacgtcgctttcacccgcattgagcagctgaaccccttcccttggcaa
caactcaaggagaacctcgaccagtaccccaacgccaagaccatcgtctggtgccaggag
gagcctctcaacgccggtgcctggagcttcactcagccccgtatcgagactctgctcaac
aacactgagcaccatacccgcaagcacgtcatgtacgctggccgaaaccccagtgcctct
gtcgccactggtctcaagaacgtccacaccaaggaggagaaggacttcctcgagatggct
ttcactgtcaagcaggacaagctcaagggtgagtaa

DBGET integrated database retrieval system