KEGG   Fusarium pseudograminearum: FPSE_05142Help
Entry
FPSE_05142        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    FPSE_05142
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FPSE_05142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 20363760
NCBI-ProteinID: XP_009256535
UniProt: K3VJR6
LinkDB All DBs
Position
1
AA seq 257 aa AA seqDB search
MFPLLPLLLLLLHLTSPTSSSSVNAKPDLASDNNILPDNIQTYSVMSVGTYSLPALPYAY
DALEPSISAQIMELHHSKHHQAYVTNLNAALKNYATATSSSDIAGQIALQSAIKFNGGGH
INHSLFWENLCPSSSPGSKPDSAPTLGAEISKTWGSIEAFQETFKKTLLGLQGSGWGWLV
KDTQGLRIVTTKDQDPVVGGEVPIFGVDMWEHAYYLQYLNGKAAYVDNIWNVINWKTAEA
RFTGSREDAFKVLRASI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccctcctacccctcctcctcctcctcctccatctcacatcacctacatcttct
tcctctgtcaacgctaaacctgaccttgcctctgacaataacatcctccccgacaacatc
caaacttattcagtcatgtctgttggaacctactctcttccggcgctgccgtacgcctac
gatgcccttgagcccagcatctcggctcaaatcatggaacttcaccactcaaagcatcac
caagcctacgtaacaaacctcaacgccgccctcaagaactacgccaccgctacttcatcc
agcgacatcgccggccagatcgccctccagtctgccatcaagttcaacggcggcggccac
atcaaccactccctcttctgggagaacctctgcccctccagctctccaggctccaagccc
gacagcgcccccacgctcggcgctgagatctcaaagacgtggggcagcatcgaggctttc
caggagaccttcaagaagactctgctgggactgcagggcagcggctggggatggctggtc
aaggacacgcagggcttgcgtatcgttaccaccaaggaccaggatcctgtcgtgggaggg
gaggtgcccatttttggcgtcgatatgtgggagcatgcctactacctgcagtacctgaac
ggaaaggctgcctatgttgacaacatctggaatgttatcaactggaagacggccgaggct
cgcttcactggctcccgtgaggatgcattcaaggtcctccgagcttccatctag

DBGET integrated database retrieval system