KEGG   Fusarium pseudograminearum: FPSE_05684Help
Entry
FPSE_05684        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00500  Starch and sucrose metabolism
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FPSE_05684
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     FPSE_05684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 CBM_48
Motif
Other DBs
NCBI-GeneID: 20364302
NCBI-ProteinID: XP_009257077
UniProt: K3W0H2
LinkDB All DBs
Position
3
AA seq 581 aa AA seqDB search
MLIQILYGLAASALWQGQVVASPSKDNSLERFIDKQADVSIKGVLANIGADGKRAQGAAP
GAVVASPSKEDPDYWYTWTRDSALTYKVIVERFIHGDKSLQRKIDEYVSAQAKLQGTTNP
SGSPESGGLGEPKFHVNLTAFTGSWGRPQRDGPPLRATALTLYAEWLISHGERSKAVNKV
WPVIEKDLVYTTKFWNRTGYDLWEEVNGSSFFTLSASHRALVEGAALAKKLEKSCPDCVT
NAPRVLCFLQSFWTGGYIDSNINVKDGRKGLDVNSILSSIHTFDPTSKCTDSTFQPCSPR
ALANHKAVVDSFRSIYGVNKNRGQGKAAAVGRYSEDVYYDGNPWYLATLAAAEQLYAAVY
QWNKVGAITVDDMSLSFFKDIVPKISKGTYSKNSKTYKETIKAVKAYADGFVAVVQTYTP
KDGSLAEQFDKSTGAPKSAVHLTWSYASFVSATERRDGIVSPSWGESSANKVPAVCQAAP
ACDTTVTFTVKNVQVTSGQKVYVVGSVTELSNWSPEDGIPLTEGTEGVWSTKVKIPSDTS
FEYKYIKKTSSGEVTWLSDPNNRALTGSKCGSTSTLNDEWR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcttatccaaatcctctatggcctggcagccagtgccctgtggcaaggccaagttgtt
gcatcaccaagcaaagacaattcgctagagcgttttatcgataaacaagctgatgtttct
atcaagggtgtccttgccaacattggcgctgatgggaaaagggcacaaggtgcagcacct
ggcgctgttgtcgcgagcccatcaaaagaagatcctgattattggtacacttggacgcgt
gattcagctttgacatacaaggtcattgtggagagattcattcacggtgacaagtctctc
caacgaaagatagacgaatatgtctctgcacaggctaaactgcaaggaaccacaaatcca
tctggtagtccagagtcaggcggtcttggcgagccaaagttccacgtgaatctcactgct
ttcacaggatcttggggtcgacctcagcgcgacggcccacctctcagagctaccgctttg
acgctgtacgcagagtggctcatttcccatggcgaacgatccaaggctgtgaacaaggtc
tggccagtcatcgaaaaggatcttgtgtatactaccaagttctggaatcgcactggctac
gatctctgggaggaggtcaatggatcttctttctttacgctttcggcttcacatcgtgct
cttgtcgagggtgcggcgctggctaagaaactcgaaaagtcctgccctgactgtgtcacc
aacgctcctcgtgttctgtgcttccttcagagtttctggacaggtggatacattgactcc
aacatcaatgtcaaggacggtcgcaagggccttgacgtcaactccatcctctcctcgatt
cacaccttcgatcccacctccaaatgcaccgactcgaccttccagccttgctcgcccaga
gctcttgcgaaccacaaggcagtcgtcgattcgttcaggtccatttatggcgttaacaag
aacagaggccaaggaaaggctgccgctgtcggtcgatatagtgaggacgtgtactatgat
ggcaacccctggtacctggccactcttgctgctgcggaacagctctacgccgcggtctac
cagtggaacaaggttggagctatcactgttgacgatatgtcattgtctttcttcaaggat
attgtccccaaaatttccaagggcacttattctaagaatagcaagacatacaaggagacc
atcaaggcagtcaaagcttacgccgatggtttcgtcgcagttgtgcagacatatactccc
aaggatggctcactagctgagcaatttgacaagtccactggagctcccaagtccgctgtc
catctcacctggtcttacgcctcatttgtcagcgccaccgaacgtcgggacggcattgta
tccccctcttggggcgagagcagtgccaacaaagtccccgccgtatgccaagctgcccca
gcatgtgacacgaccgtcaccttcactgtcaagaacgtgcaagttacgtctggtcagaaa
gtttacgtggttggttccgtgactgaactttccaactggtcacctgaagacggcattccg
cttacggagggtactgagggtgtgtggagcacaaaggttaagattccttctgatacaagc
tttgagtacaagtatatcaagaagacgagtagtggcgaggttacttggttgagtgatccc
aacaatcgagctcttacgggtagcaagtgtgggagtaccagtactctcaatgatgagtgg
aggtag

DBGET integrated database retrieval system