KEGG   Fusarium pseudograminearum: FPSE_06201Help
Entry
FPSE_06201        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00020  Citrate cycle (TCA cycle)
fpu00190  Oxidative phosphorylation
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
fpu01130  Biosynthesis of antibiotics
fpu01200  Carbon metabolism
Module
fpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fpu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FPSE_06201
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FPSE_06201
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FPSE_06201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 20364819
NCBI-ProteinID: XP_009257594
UniProt: K3VJU5
LinkDB All DBs
Position
3
AA seq 278 aa AA seqDB search
MAALRSSSRLVGAFSRTAAIRPGTVFTRSMASVSEPAKGPESKLKSFQIYRWNPDTPSEK
PRLQTYTLDLNKTGPMILDALIRIKNELDPTLTFRRSCREGICGSCAMNINGQNTLACLC
RIPTEAASDVKIYPLPHTYVVKDLVPDLTHFYKQYKSIKPYLQRDTPAEDGREYRQTKED
RRKLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWLADSRDQRTAERKQNLEN
SMSLYRCHTILNCTRACPKGLNPGKAIAEIKKQMAFGN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctccgatcttcctctcgccttgttggcgccttctcaaggacggctgccatt
cgccccggcactgtcttcactcgttctatggcctcggtcagcgagcctgccaaggggccc
gagtccaagttgaagtccttccagatctaccgatggaaccccgatacccccagcgagaag
ccccgtcttcagacctacactctggacctcaacaagactggacccatgattctcgatgcc
cttatccgaatcaagaacgagctcgaccctactctgaccttccgacgaagttgccgtgag
ggtatctgcggtagctgtgccatgaacatcaacggccagaacacccttgcctgcttgtgc
cgtatccctaccgaggctgcttctgacgtcaagatctaccctcttcctcacacctacgtc
gtcaaggaccttgtccctgatctgacacacttctacaagcagtacaagagcatcaagcct
tacctccagcgcgacacccctgccgaagacggacgtgaataccgacagaccaaggaggac
cgacgcaagctcgacggtctctacgagtgcattctctgcgcctgctgctctacttcatgc
ccatcttactggtggaactctgaggagtacctcggtcccgctatcctgctccagtcttac
cgatggctcgccgattctcgtgaccagcgcactgccgagcgaaagcagaacctcgagaac
tcaatgagtctgtaccgttgccacactatccttaactgtacccgagcctgccccaagggt
ctcaaccctggtaaggcgattgccgagatcaagaagcagatggctttcggtaactag

DBGET integrated database retrieval system