KEGG   Fusarium pseudograminearum: FPSE_06229Help
Entry
FPSE_06229        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
fpu  Fusarium pseudograminearum
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpu03036]
    FPSE_06229
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     FPSE_06229
Chromosome and associated proteins [BR:fpu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     FPSE_06229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 20364847
NCBI-ProteinID: XP_009257622
UniProt: K3UN39
LinkDB All DBs
Position
3
AA seq 1139 aa AA seqDB search
MASSSRPPLSLRRHSSIRHLRQPEHDDLAQSLNQLNISTSPGRAPSRLASEPASPFRPSG
RRTSQSPAPNARAPSRSPSQDPSLGTPTLLRKASMNSLRSSNGIGPGSTSRRSSVAHVMS
PTRRASYQEKIRPTPRSIAHDNLKAELHAHHGSITTRPTQTIVVLNDAVYGHRFSRPRTS
RAALGTIVERPERIRAAVLGVSAAYVRLGGRHCEGEYPLHPGREAEHLQGIPFRIHKTDR
TLSLLSPAVVNVHGAKWMEELKTMCEAAESKLALGGKELQRPEMNRGTDKSPEKFHEGDL
YLCSESLNAMEGALGAVCEAVDTVFGPGPRRAFVGVRPPGHHCSASYPSGFCWVNNVHVG
IMHAAVEHGLTHAAIIDFDLHHGDGSQAITWQHNTRANNAAKNAAAWKKSSIGYFSLHDI
NSYPCEMGDEEKVRSASICIDNAHGQTVWNVHLEPWKSEEDFWKLYETRYTVLLEKVRNY
FKNQAERLRESKEPPKAAIFLSAGFDASEWEGEGMQRHKVNVPTEFYARIAQDVVKLAAE
EGLHVDGRVISVLEGGYSDRALCSGIMSHLSGLAGDQTSEQSSDSAGSFGVDTAQTSPST
VPHGVEQKSALDSIHAYDPSWWSTSNMEELEILMGDPNAAASKYPQYVTLPSYFAPTQAS
TAKSSDPTKMQRSLSKLGSATPRFPSPPPPEVPWAVATHELSKLLIPSTRETGSCRPEDL
NAEASRVRRDRQSILMGIDPNPPPKASTSRPTSRMSLRERRAKPAPPPEPTIDKPPKGRR
STMGPTTVASEKAVARGVPSRTNSDEPGVRRSSRRLSEIPVSLTSRLSSPEAVLPEADEH
AQTVPNSPAATTATTAAPNGDLQVKKTRNPAAPRKEPAPKVPRPTKKATTATGPSRPASA
AQKAKSPERAPKNGTAGDDVDNITSGMRKIRINLITQSQKAAKARARLEAEKVNGSVSAI
DQAKPVETPSTAAHPSKAQSDDPNTVVVSTEACNHSPAQSLPINPTPPATTSSSGNITPL
QEQDPFNPSGYVSRLASPPPSSPPIPSVSVHPSAEAGDVFIPYQPEGPAPKPITQNEPLK
WLPPNVPTSSAQTPATTPSPIKKNKLFQYASSSGIPFAPRTGHQAKGAATTKPAGPEMK
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcatcccgcccaccactgtcgcttcggcggcattcctccatccggcatctt
agacagcctgaacatgacgacttggctcagtcgttgaaccaactcaacatctccacttcg
cccggccgagctccgtcccgccttgcctccgaacctgcctctcccttccgtccatcgggc
cgccgtacttcgcagtcaccagcaccaaatgcccgagcaccttcacggagcccttcccag
gacccctccttgggcacgcctaccctcctgcggaaagcctccatgaactcattgcgctct
tctaatggaatcgggcctggttcaacgtcgagacgttctagcgtggcacatgtcatgtca
ccgacacgcagggcgtcttatcaagaaaagattcggccgacacctcgttctattgctcac
gacaacttgaaagccgaattgcatgcacatcatggctctatcaccacccgtccgacccaa
acaattgtggtgctgaacgacgctgtctacggccaccgtttctcccgaccccgaacttct
cgtgccgccctcggtaccattgttgaacggccagagcggataagagctgcagtgttgggt
gtgtccgcagcctatgtgcgcttgggcggcaggcattgtgaaggtgaatacccactccac
ccgggaagggaggcagagcatctccaagggatccctttccggatacacaagacggatcgc
actctttctcttctttcaccagccgtagtcaatgtacatggagcgaaatggatggaggag
ttgaagacaatgtgcgaggcggccgaatcgaagcttgcattgggcggaaaggaactccaa
agacccgagatgaatcgggggactgacaagtctcccgagaaatttcacgaaggggacttg
tacctctgctcggaatctctcaatgctatggaaggcgccctcggggcagtttgcgaagcc
gtcgacacagtatttggtccgggtccgcgccgtgccttcgtaggcgttcgacccccgggt
catcactgttctgcttcttatccttctggtttctgttgggtcaataacgttcatgttggt
atcatgcacgcagctgtcgagcacgggctcacccatgctgctatcatcgactttgacctt
caccacggcgatggatctcaggctattacatggcagcataatactcgagcgaacaacgct
gccaagaacgcagcagcgtggaaaaagtcgtcaatcggctacttcagcttacacgacatc
aactcgtacccgtgtgaaatgggcgatgaagaaaaggttaggagcgccagtatctgtatc
gacaacgcacacggccaaacggtttggaacgttcacctcgaaccatggaagtcagaagag
gatttttggaaactctacgaaacgagatataccgtcctcttggaaaaggttagaaactac
ttcaaaaatcaggcagagcgattgagggaatctaaagagccgcccaaggctgcaattttc
ctgtctgctgggtttgatgccagcgagtgggagggtgaaggcatgcaacgccacaaggtc
aatgtcccgaccgaattttatgcgcgtattgcccaagacgttgtcaagctcgcagctgaa
gaaggcctccacgttgacggccgcgttatcagtgtattggaaggtggctacagtgaccga
gctttatgttctggcattatgagccatcttagtggactggctggtgatcagacaagcgag
caatcatcagacagcgccggctcttttggagtcgacacggctcagacgtcaccaagcacg
gtaccacatggcgttgagcaaaaatcagcattagactccatccatgcttacgacccgtca
tggtggtcgacttcaaacatggaggagctcgagattttaatgggcgaccccaatgctgcc
gcttccaaatacccgcaatatgtcacccttccatcctactttgctccgacacaggcgtca
acggctaagtcctcagatcctacgaagatgcagcgtagcttgtccaagttaggctcggcc
acgcccaggtttccatcgccgccgccaccagaagtcccctgggcggttgcaactcacgaa
cttagcaaactccttatcccctccacacgcgaaactggtagttgcaggcctgaggatctg
aacgcagaagcaagcagggtcagacgtgaccggcaatcaatattaatgggaatcgaccct
aaccctccgcccaaggcttctacttcacgtccaacatcgcgaatgtctctgcgcgagaga
cgagccaagccagcaccaccccctgagccaaccatcgacaagccacctaaaggtcgcaga
agcacgatgggccccactactgtcgcttcagaaaaggcggttgcccgcggcgttccctca
cgaacaaacagtgatgaaccaggagtgaggaggtccagccggcgtcttagcgagatcccg
gtgtctctcacttcacggttatcttctcctgaggcagtcctgcccgaagctgatgaacat
gctcaaacggtgcccaactctcccgcggctacaacggccacaacggcagctccaaacggc
gacttgcaagtcaagaaaactcggaatcctgctgctcctcgcaaagagcctgcacctaag
gtacctcggcctaccaagaaagccaccacggcaactggtccttcacgtccagcttctgcc
gcccaaaaggccaagtcaccagagcgagctccaaagaatggcacagcgggcgatgacgtt
gacaatatcacttctgggatgaggaagattcgtatcaacttgatcactcagtcccaaaag
gctgctaaagcacgtgctcgccttgaagctgagaaagtcaacggcagcgtctctgctatc
gaccaggctaagcctgtcgaaacgccatctactgctgcgcatccatcaaaagcccagtct
gatgacccgaacacggttgttgtgtctactgaggcttgcaaccactctcctgcgcagtcg
ctgccaatcaaccctacaccacctgccactacttcatcgagcggcaatatcactcctttg
caggagcaggatcctttcaatccttctgggtatgtttctcggttggcctctcctccgccg
agttcgccacccattccctcagtttctgtccatcctagcgcagaagcaggtgatgtcttt
attccctatcagcccgaaggtcccgcacccaagcccatcactcagaacgagccattaaaa
tggctccctcctaatgtgccgacttcttctgcacaaacaccagccacgacacccagtcca
atcaagaagaataaactcttccagtacgcttcttcttctgggattccttttgcgccccgc
accggacatcaggcaaaaggtgccgcgactactaagcccgcggggcccgagatgaagtag

DBGET integrated database retrieval system