KEGG   Fusarium pseudograminearum: FPSE_07053Help
Entry
FPSE_07053        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
Organism
fpu  Fusarium pseudograminearum
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH Pyr_redox Pyr_redox_2 ADH_N_assoc FAD_binding_3 adh_short Lyase_1
Motif
Other DBs
NCBI-GeneID: 20365671
NCBI-ProteinID: XP_009258446
UniProt: K3VF73
LinkDB All DBs
Position
4
AA seq 363 aa AA seqDB search
MTSTQSVKAVRYHGQQDIRLESVPVKPLDPTTVRIAPKFCGICGTDVHEYLGGNNLIPKP
GTPHGITGETSPLTLGHEFSGIVEEVGSEVTRLQKGDRVCVQPIIYDNECRSCKRGLQNC
CDKNGFIGLSGWGGGLAESTVVPQDAVKKLPDNVSLEVGALVEPLAVGWHATKISPYEDG
NSAFVVGGGPIGLAVVQALVGRGCKNIMLTEVSSKRREFAKKFGAHHVFDPTKDDVVAMV
KKLTGGLGADVGFDAAGSQHAIDVAFDCLKARAVLVNIAVWEKRAQLNMNQIVFRERSYV
GCATYALGDFEEVIDALSNGKITPEGMITKVIKMDKVVEEGFQTLINDKDNHVKILVDVS
AGV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaacacaatcagtcaaggctgtccgctatcacggtcaacaagacatccgtctt
gaatccgtaccagtcaagcccctagaccccactactgttcgcattgctcccaagttttgt
gggatctgcggtacagatgtccacgagtatctcggcggcaacaatctcattcccaaaccc
ggcaccccgcacggcatcactggtgagacgtcaccacttactctgggccacgaattcagc
ggcatcgtcgaagaagtcggcagtgaagtcacgcgtcttcaaaagggtgaccgcgtttgc
gtgcaacctatcatctacgacaatgagtgtcgctcgtgtaagcgtggtcttcaaaactgt
tgcgataagaacggcttcatcggtttgagtggttggggaggtggattagctgaatcaact
gtcgtgccacaggatgctgttaaaaaattacccgataatgtctccctcgaagttggcgct
ttggttgagcctctggctgttggatggcacgcaaccaagatttcgccctatgaagacggc
aactcagccttcgttgtcggcggcggaccaattggactggctgttgtgcaggccctcgtt
ggacggggatgcaagaacatcatgttgactgaggtcagttccaagagacgagagtttgcc
aagaagtttggtgcgcaccacgtattcgatcctacaaaggacgacgtcgtggcgatggtg
aagaagttgacgggaggtctaggagcagatgttggtttcgatgctgcgggctcgcaacat
gctattgatgtagcgttcgattgcttgaaggctagggcggtgctggtgaacattgctgtg
tgggagaagagggcgcagttgaacatgaaccagattgtgttccgggagagatcttatgtt
ggatgcgcgacatatgctctcggagattttgaagaagttatcgatgctctgtcgaatggc
aagatcacacccgagggaatgattaccaaggtcatcaagatggacaaggttgttgaggag
ggtttccaaactctcattaacgacaaagataaccacgtcaagatcttggttgatgttagc
gctggagtatag

DBGET integrated database retrieval system