KEGG   Fusarium pseudograminearum: FPSE_07630Help
Entry
FPSE_07630        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00564  Glycerophospholipid metabolism
fpu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FPSE_07630
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FPSE_07630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA HI0933_like 3HCDH_N NAD_binding_8 Pyr_redox_3 Pyr_redox DUF4148
Motif
Other DBs
NCBI-GeneID: 20366248
NCBI-ProteinID: XP_009259023
UniProt: K3UJR7
LinkDB All DBs
Position
2
AA seq 686 aa AA seqDB search
MQQRLRSMKRPLLLAAAATTTLAVGGGYYATRNRTHVVDKALVPLKRDQTGRIVPPTFSA
TKARAEALAELRRSGQPNKDTEYDLLVIGGGATGTGIAIDAITRGLKVALVERDDFSSGT
SSKSTKLVHGGVRYLEKAVWNLDYGQLQLVMEALRERKTFLNIAPHLSSSLPILLPLQKW
WEAPYFWAGTKAYDLLAGSQGLESSYYMSKNKAMEAFPKLRRENMVGALVYYDGQHNDSR
MNVALAMTAAQYGATVLNHVEVTGLEKDANGKISGAQVRDVLASKNGDSANAEPFKVRAK
GVVNATGPFTDAIHQMDDPSRKPIVAPASGVHVMLPKDICPNGIGLLDAATSDGRVIFVL
PWQGFTLAGTTDNPCEVERAPVAQQNDVDFILREVSKLLTPESALSRKDVQAAWSGIRPL
VKNPNAKNTESLVRSHLITTSPSGLLTCAGGKWTTYREMAEDTVNEAVKMFELKPQAVSL
PDISGANASGFTTSGLCCTRNIPLIGAHGYSTSLASQLMEMYPIDADVADHLAHNYGDRA
WTVLSTNPSLNTRLVSGLPYLEAEVAHGIRNEAACTVADIIARRTRLSFLDSSKALQALP
RVIDIAATELQWSKARKAQEKADSIAFLASMGLEQMTDAPVQASQQERMPARQIEHSQQR
PARVGGLEVDLNGLGSTSSYSKSRDD
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaagattacggtcgatgaagcgccctctgcttctcgcagctgcggccacaaca
actctcgctgtcggaggcggctactacgcaacccgcaacagaacccacgtcgtcgacaag
gccctcgtccctctcaagcgcgaccaaacagggcgcatcgtccctcccacattcagcgca
acaaaagcccgtgccgaagccctcgccgagctgcgccgcagcggccagcccaataaagat
actgagtacgacctcctcgtcattggcggtggcgctacaggaactggtatcgctatcgac
gccatcacccgcggtctcaaggtcgctctcgtcgagcgcgatgacttctcctccggcaca
agctccaagagcacaaagctcgtccacggcggcgttcgatacctagaaaaggctgtatgg
aaccttgactacggtcaattgcagctcgtcatggaggctctccgcgagcgcaagactttc
ctcaacattgcgccccatctgtccagctcgcttcccatcctacttcccctccagaagtgg
tgggaggcgccctacttctgggccggcaccaaggcctacgatctcctcgctggctcccag
ggtctcgagagctcttactacatgagcaagaacaaggccatggaggctttccccaagctg
cgcagggagaatatggtcggtgctctggtttactacgatggccagcacaacgactcccgc
atgaacgtcgctctcgctatgacagctgcgcaatacggtgccaccgttctcaaccatgtt
gaggttaccggtctcgagaaggatgccaacggcaagatcagcggcgctcaagtccgcgat
gtcctcgcttccaagaacggtgactctgccaacgctgagcccttcaaggtccgcgccaag
ggtgttgttaacgctactggtcccttcaccgatgctatccaccaaatggatgacccctct
cgcaagcctatcgtcgcccctgcttcaggtgtgcacgtcatgcttcccaaggacatctgc
cccaacggtatcggtctcctcgacgctgctacctcagatggccgtgttatcttcgttctt
ccctggcaaggattcaccctcgctggtaccaccgacaacccctgtgaggtcgagcgcgca
cccgttgctcagcagaacgacgttgacttcattctccgtgaagtcagcaagcttctgact
cccgagtccgctctttcccgcaaggacgtccaggctgcctggtctggcatccgacctctc
gtcaagaaccccaacgcgaaaaacaccgaatccctcgtccggagccacctcatcaccacc
tctccctccggtctcctcacatgtgccggtggcaagtggactacataccgtgagatggct
gaggacactgtcaacgaggccgtcaagatgttcgagctcaagccccaagctgtctctctc
cccgacatcagcggtgccaacgcaagcggcttcaccacctctggcctttgctgcactcgc
aacattcctctcattggcgcccacggatactctacttctctggcctctcagttgatggag
atgtaccccatcgacgccgacgttgctgaccacctcgctcacaactacggcgatcgcgcc
tggactgtcctctccaccaacccctccctcaacacccgccttgtctccggtcttccctac
ctcgaggccgaggttgcccatggtatccgcaatgaggctgcctgcactgttgccgacatc
atcgctcgccgcacccgtctctcattcctcgactccagcaaggctctccaggctctcccc
cgcgtcatcgacattgccgctactgagctccagtggtccaaggcccgcaaggcccaagag
aaggctgacagcattgctttcctcgcctctatgggtctcgagcagatgaccgacgcgcct
gtccaggcctctcaacaggagcgcatgcccgctcgtcaaattgagcacagccaacagcgc
cccgctcgcgtcggtggtctcgaagttgacctcaacggtctcggcagcactagctcctac
agcaagtcccgcgacgactaa

DBGET integrated database retrieval system