KEGG   Fusarium pseudograminearum: FPSE_09407Help
Entry
FPSE_09407        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    FPSE_09407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpu03036]
    FPSE_09407
Enzymes [BR:fpu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     FPSE_09407
Chromosome and associated proteins [BR:fpu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     FPSE_09407
   HMT complexes
    COMPASS/SET1 complex
     FPSE_09407
    COMPASS/SET1 complex (yeast)
     FPSE_09407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET
Motif
Other DBs
NCBI-GeneID: 20368024
NCBI-ProteinID: XP_009260799
UniProt: K3VD92
LinkDB All DBs
Position
4
AA seq 1263 aa AA seqDB search
MTRPPGASFAEFFPTAPKVKAQAQTRADQVRDRDRSKTASTPATINGTIDSTTGTAVLEA
DANISLNGIVSASDTMPTQPDDTESPFTDIPNTVDSASSYSSAASSIFSTSTRHGAAATT
ASSRLPTSSLTPSAFKESPNSAPAAAKPDMSTYQTSDRATRQSSRNSLATGPNVSISNGL
PSNERIPARDPLPSVKGLRCTYDPLLDRVHNKSVSKSAKPIYKEFGREDDAPPPKDPRLA
RSDGRLGYINTDYYLPKSRLRTAPENIKPYPYDPKTSIGPGPPTQIVVTRYNPLIPFSKV
TAIFASFGEIAESSNKMHPETGSYLGFATIRYRDSKRPDRPPVSGIDAARRAVRARGIKV
DADIVRVEYDAEGRRSRRMLEEHLKREKEKFEKIEQERLALAAKAPPTGPKSGTAPAFTR
PPPTAPKGPSAQRQSIPTSAPQIPLLGTQVQGLNLEPSNLAQKLTDDPYIYVTGDSVPVL
PSILPHMKKRLKSYGFEEIRVDKSGYFIVFRNSFTGSSEAERCFRAVNHTEFFNYDMTMQ
LCLPRPRREDGSGRRRSSASLDRHTHAEPRYRDEKDRRRREEEADLEEEKKQRAKNFDPV
IEAVEVVRREMMEHLIRHIRTKVAAPALSDFLDPANHAAKRRKLNIEHPDDLQEIPSIED
GNDSSRVGTPNSRADPIERRTGRLEPKALPRIRKTKVKGQAQKSAFVDPFARKRPPVARN
AFRSLHHRLRSLDSDAESDDDTDTRALLARETEEADSRPRSRMSTDDEASKDDFVPWEQG
EDDSMTEASFAIADTASTRKRKLVASLESVFKRQKKSDEELFGVNLETLDSEFKGREDSV
DIIPEPETGDDVESRVSRSETPASAISKPLKKRPGKGKKTKKASFEEPEASKIQPGTEIQ
PGDEATEPSKVKQEKAEKTSMEELIPEKFDEKLFATEPLTPALELPDGAKPDLPTFQGLT
VSVQDIPDLTRLARRFNTKDIGNAELWLWTRNRIRELNSARRTLDSPVTIGGYYVPNPTG
CARTEGVKKILNSEKSKYLPHHIKVQKARQEREARNKLGRDAAAEAADAARIAAEKLVAK
GNSRANRATNRRYVADLNDQKKTLGQDSDVFKFNQLKKRKKPVKFARSAIHNWGLYAMEN
IAKDDMIIEYVGEQVRQQISEIRENRYLKSGIGSSYLFRIDDNTVIDATKKGGIARFINH
SCMPNCTAKIIKVEGSKRIVIYALRDIALNEELTYDYKFEREIGSTDRIPCLCGTAACKG
FLN
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcccgccaggcgcgagcttcgcggagttcttccccactgctcccaaggtaaaa
gctcaggctcagactcgcgcagaccaggttagggatcgcgatcgctctaaaacagcatcg
acaccagccactatcaacggcaccatcgactccacaacaggtacagctgtgctagaagcc
gacgcgaatatcagccttaacggcattgtttcagcgtcggatactatgccaacacaacct
gacgacaccgaatccccattcacagatatccccaacaccgtcgactcggccagctcatat
agcagcgcggcttcatcgatattcagcacatccacccgccacggtgccgcggcgactaca
gcttcgtcccgtcttcccacttcgagcctcactccaagcgccttcaaagaatctcccaac
tcggctccagccgccgcaaagccagatatgtctacgtatcagacctccgatcgggccacg
agacagtcctctcgaaactcactggccactggcccgaatgtctcgatatcaaacggactt
ccctccaatgagcgcattccggctcgagatcctttgccctccgtcaagggcctcagatgc
acctatgatccgctcctcgatcgagtacacaataagagcgtcagcaaaagcgccaaacca
atatataaagagttcggtcgagaagatgacgccccccctcctaaagacccccgactggcc
aggtcggatggtcgcctcggttatatcaacaccgactactacctacccaaatcacggcta
cgaacagcgcctgagaacatcaagccctatccctacgatcccaagacctccattggccct
ggcccacccacacagattgtcgtgacaagatacaatccgctcattcccttcagcaaggtg
acggctatctttgctagtttcggcgagatagcagaaagcagcaataagatgcacccggag
acaggtagctatcttggatttgcgacaattcgatatcgagattctaagcgacccgatcgt
ccgcctgtctctggtattgatgcagctcgccgtgcggtgcgagcccgtggaatcaaggtc
gatgcagacatcgttcgtgtagagtacgatgccgaaggtcgtaggagccggcgaatgttg
gaagaacaccttaagagagagaaggaaaagtttgagaaaatcgaacaggaacgactcgct
cttgcagccaaagcaccaccgaccggcccaaaatctggaacagctcctgccttcacgaga
cctcccccaacggccccgaaaggtccatcggcccagcgacaatctataccaactagtgca
ccacaaatacctttgcttggcacgcaagtccaagggctcaacctagaaccgtcgaatctc
gcacaaaagctcacggacgatccatatatttacgttacaggcgacagtgtcccagtctta
cccagtatccttccccacatgaagaaacgacttaagagttacggcttcgaggagatccgt
gtcgacaagtcgggttattttattgtcttccgcaattcgtttactggcagctcggaagct
gagcgatgtttccgcgctgttaaccacaccgaattcttcaactatgatatgaccatgcag
ctttgcttacctcgtcctcgtcgagaggatggctccggtcgtcggcgatctagtgcgagc
ctcgaccgacatacacacgccgaaccacggtatcgtgacgaaaaggatagaagacgccga
gaggaagaagcggatcttgaagaggagaaaaagcagagggctaagaactttgaccctgtg
atcgaggcggtagaagttgttcgacgtgagatgatggaacatcttatacggcatatccgc
accaaggtcgcagcgcctgctctctcggacttcctggaccccgccaaccatgctgccaag
cgacgaaagctgaacattgagcatcccgacgacttgcaagagatacccagcatcgaggac
ggcaatgacagctctcgtgtgggaacacccaactctcgtgctgacccaattgagcgccga
actggtcgtctcgaaccaaaggctcttccaagaattcgcaagaccaaggtcaagggccag
gcacaaaagagtgcctttgttgatccgtttgctagaaagcgtccacctgttgcccgaaac
gccttccgctctctccatcaccgcctgagaagccttgacagcgatgctgaatccgacgac
gacacggatacccgtgcactattagctcgagagacagaagaggccgattctcgcccacgt
agccgaatgagcaccgatgatgaggcttccaaggatgatttcgtaccctgggaacaaggc
gaggatgactcgatgaccgaggccagtttcgccatagcagacacagcaagcactagaaaa
cgaaagttagtcgcttcacttgaatcggtctttaagcgccagaagaaatcggatgaggaa
ctatttggcgtcaaccttgaaacacttgattcggaattcaaggggcgcgaagactctgtc
gacatcattcccgagccagaaacgggcgacgacgtggaaagtagagtttcccgttctgag
accccggcctcggccattagcaagcctctaaagaagaggcctgggaagggaaaaaagacg
aagaaagcgtcatttgaagagcccgaggcctcgaaaattcaaccagggacagagatacag
cccggcgatgaagccacagaaccttccaaggttaagcaagagaaggcggagaaaacgtct
atggaagaactaatcccggagaagtttgacgagaagctctttgctaccgagcccttgaca
cctgcccttgagttaccggacggcgctaagcccgacttaccaacattccagggcttgaca
gtcagtgtccaagatatacctgatctgaccagacttgccaggaggtttaatactaaggac
atcgggaatgcggagttgtggttgtggacacgcaaccgcatcagggagctcaactctgca
agacgcacgctggactctcctgttactattggaggatattacgtgcccaatcctactggc
tgtgcccgtacggaaggtgtcaagaagattctcaactcggaaaagtcgaagtacctccct
caccatatcaaggtgcagaaggcaagacaagaacgggaggcccgcaacaagttgggcaga
gacgccgctgcagaagccgcggatgccgccagaatcgctgccgagaaactggtcgccaag
ggaaactcacgagcgaatcgcgctaccaaccgtcgctacgttgctgacctcaacgatcag
aagaagactctcggtcaggactctgatgtcttcaaattcaaccagctcaagaagcgaaag
aagcccgtcaagtttgctcgttcggctattcataactggggtctatacgccatggagaac
attgcaaaggacgacatgattatcgagtatgtcggtgagcaagttcgacagcagatctcc
gaaatccgcgagaaccgatatctcaaaagtggcattggaagcagctatttgttccgcatt
gacgacaacactgtcatcgacgcaaccaagaagggtggcattgcgcgattcatcaaccac
agttgtatgcccaactgtactgccaagatcatcaaagttgagggaagcaagcgcattgtc
atctacgcgttgcgcgatattgccctgaacgaagagctgacgtatgattataaattcgag
cgtgaaatcggcagtactgaccgcattccttgtctctgcggcactgcggcctgcaagggc
ttcctcaactga

DBGET integrated database retrieval system