KEGG   Fusarium pseudograminearum: FPSE_10272Help
Entry
FPSE_10272        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00052  Galactose metabolism
fpu00500  Starch and sucrose metabolism
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FPSE_10272
   00500 Starch and sucrose metabolism
    FPSE_10272
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     FPSE_10272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 20368889
NCBI-ProteinID: XP_009261664
UniProt: K3UDA8
LinkDB All DBs
Position
2
AA seq 960 aa AA seqDB search
MFFKKLLTSAAALTGTALAQSKAGVDDLDKPRRDLFEKDLSKCPGYKATKHWETHSGFYA
DLSLAGEACDVFGIDLPKLKLEVEYQTEDRLHVKILDTNNTVYQVPDDVFPRPGFGQWAS
PKNSKLKFDFKADPFSFTVSRRDTDEVLFDTSGSDLVFESQYVYLKTKLPDHPHLYGLGE
HSDPFMLNSTNYTRTIYTRDSYGTPKGQNLYGAHPIYFDHREKGTHGVFLLNSNGMDVFI
DKKKDQQFLEYNIIGGVLDFYFVAGPSPREVAKQYAEIVTLPLMAPYWGLGFHQCRYGYR
DVYEVAAVVANYSAAGIPLETMWTDIDYMDRRRIFTIDPERFPADKYKDLVDTIHARDQK
YIVMVDPAVYDMESNPALDSGLEYDTFMKEPNGSDYRGVVWAGPSVFPDWFNPNSQKYWN
DLFINFFDGENGPDIDGLWIDMNEPANFFNRPYPGNNTTPEKFAEIDGDPPKPPPVRDGP
PAPIAGFPDSLQPASSRRKTREVASIAKTTIHKRTVAVRTTPRSRGVGQWAAKKHWGQNK
YGRPGSSWQSGKKTGSGCGEDECKGLPNRELIQPPYMIQNGAGPTLADSTTDTDLVQSGD
YLQYDTHNLYGAQMSTHSHNAMRARRPDKRALVITRSTFAGSGKDVSHWLGDNLSIWDQY
RFSIGQLLQFASIYQIPVVGADVCGFGGNVTETLCARWATLGSFYTFFRNHNEITAASQE
FYRWPKVAEAARTGIAIRYKLLDYIYTAIYKQNQTGTPTLNPLFFNYPNDKNTYSIDLQF
FYGDGILVSPVTKENSTELEYYLPDDIFYEWSTGKPVRGTGSYESAEVELTDIMVHYKGG
IIYPQRIESANTTTALRKKGFNLVIAPGLNGKAHGSLYLDDGESVVQDAVSEIDFSYTKG
KLSMSGSFEYDAGVKIETITILGVDKKPKGTDHAEYDSENKKLTFKADVPLTKKCYVDLF
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcaagaagctgctcacctccgccgcagcccttacaggcactgcgcttgcccag
agcaaagcaggcgtcgatgacctcgacaagccccgcagagaccttttcgaaaaggacctc
tccaagtgtcccggctacaaagccacaaagcactgggagactcattctggattctacgct
gacctctccctcgcgggtgaggcttgcgatgtctttggaattgatctgcccaagctgaag
cttgaggttgaatatcagactgaggaccgactgcacgtcaagatcttggatacaaacaac
actgtttaccaagtcccagatgatgtcttccctcgtcctgggtttggacagtgggcttca
ccaaaaaactccaagctcaagtttgactttaaggcggatcccttctcgttcactgtttcc
agaagggataccgatgaagtgctctttgatacgtcgggaagcgacctcgtctttgagagc
cagtacgtctatctcaagactaagctccccgaccatcctcacctctacggccttggcgag
cacagtgatcctttcatgctgaactcgaccaactacacccgcactatctacacccgcgac
tcatacggtacacccaagggccagaacctttatggagctcaccccatctactttgaccac
cgagagaagggcacccatggtgtttttctcctcaactccaacggcatggatgtattcatc
gacaagaaaaaggaccagcagtttttggagtacaacatcattggcggtgttctcgacttc
tactttgtcgctggaccttcgcctcgtgaagtcgcgaagcagtacgctgagattgttact
ctgcctctcatggcgccttactggggtctcggtttccaccagtgcagatacggctatcgc
gatgtttacgaagttgctgctgttgtagccaactactccgctgctggaatcccactcgag
actatgtggactgatattgactacatggaccgtcgacgtatctttactatcgacccagag
cgtttccctgcggacaagtacaaggatctcgttgatacgatccacgcaagagaccagaag
tacatcgtcatggttgatcccgccgtgtatgacatggaatccaaccctgcccttgactca
ggcctcgagtacgacacgttcatgaaagagcccaacggctcagactaccgaggggtggtc
tgggcagggccttctgtttttcctgactggttcaaccccaactcgcaaaagtactggaac
gatctctttatcaacttcttcgatggtgaaaacggtcctgatatcgatggtctctggatt
gatatgaatgagcctgccaactttttcaaccgtccttatcctggcaacaacaccactcct
gagaaattcgcagagatcgatggtgatccccccaagcctcctcctgttcgtgatggccct
cctgctcccattgctggcttccccgatagtctgcagcccgcatcttctcgccgcaaaaca
cgtgaggttgcttctatcgccaagactaccatccacaagcgcactgtggcagtccgcaca
acaccccgcagccgtggtgtaggacaatgggcagccaagaagcactggggccaaaacaag
tatggtcgtcccggctccagttggcaaagcggcaagaagacaggatctggttgtggcgaa
gatgagtgcaagggtcttcccaaccgagagcttatccagcctccctacatgatccagaac
ggcgctggacctacgctcgctgacagcactaccgataccgaccttgtgcagagcggagac
tacctccagtatgatacacacaacttgtacggtgctcagatgtcaacacactcgcataac
gctatgcgtgctcgacgccccgataagcgtgctcttgttatcacgcgcagtacctttgct
ggctctggcaaggatgtttctcactggcttggagacaacctctctatctgggaccagtac
cgcttcagcattggccaacttctccagtttgcatccatctaccagattcccgtggttggt
gccgacgtctgtggcttcggcggcaacgtcaccgagactctttgcgctagatgggctact
cttggaagtttctacaccttcttccgtaaccacaacgagatcaccgctgcatctcaggag
ttctaccgttggcccaaggtcgctgaggcagcccgaactggtatcgccattcgctacaag
ctcctcgattacatctacactgctatctacaagcagaaccagacaggcacccctactctc
aaccctctgttcttcaactaccctaacgacaagaacacctactctatcgaccttcagttc
ttctacggtgacggcatccttgtcagccctgttaccaaggagaatagcactgagttggag
tactacctccccgatgacatcttttacgagtggtcaaccggaaagcctgtccgtggcact
ggttcatacgagtctgcagaggttgagctcactgatatcatggtccactacaagggcgga
atcatttatccccagcgtatcgaaagtgccaacactaccaccgctctgcgcaagaagggt
ttcaacctggtcattgcacccggtctgaacggcaaggcacatggatctttgtacctcgac
gatggcgagtctgttgttcaagacgccgtgtccgagattgacttctcttacaccaagggc
aagctgagtatgagtggaagctttgagtacgatgccggtgtcaagattgagacgatcacc
attcttggtgttgacaagaagcccaagggaactgaccatgcagagtatgactctgagaac
aagaaactgaccttcaaggcggatgttcctttgacgaagaagtgttatgtagatctcttt
taa

DBGET integrated database retrieval system