KEGG   Fusarium pseudograminearum: FPSE_11337Help
Entry
FPSE_11337        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fpu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FPSE_11337
Enzymes [BR:fpu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FPSE_11337
Transporters [BR:fpu02000]
 Other Transporters
  Pores ion channels [TC:1]
   FPSE_11337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_2 GST_C GST_N_3 GST_C_3 GST_C_2 GST_N_4 DUF3067
Motif
Other DBs
NCBI-GeneID: 20369954
NCBI-ProteinID: XP_009262729
UniProt: K3V5W5
LinkDB All DBs
Position
1
AA seq 213 aa AA seqDB search
MSELEPITVYVHSAGPNPFKVTILLEELAVPYTTIVVEDPKEDWFVAINPNGRVPAIKDP
NSDIVLWESGAIMEYLVETYDVNQRLCGTSTSSKWEIKQYLHFQVSGQGPYYGQAMWFHK
CPQDIPLAKERYVNEIARVISVLDKVLAGRKYLVDGKLTYADLAFVPWNRVVSQHPFFKT
SLWEKHTILKQYPSFSAWQERLNDLPSVKAAYK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagctggagcccatcacagtttatgttcacagcgctggtccgaaccctttcaag
gtgactatcttgctggaggaacttgctgtcccttacacaacgattgttgtcgaggaccct
aaagaggattggtttgtcgcaatcaaccccaatggcagagtgccggctatcaaagacccc
aacagcgatatcgttctctgggaatctggagccatcatggaatatctggttgagacttat
gacgtaaatcagagactatgtggtacaagcacatccagcaaatgggagatcaaacagtat
ctacacttccaagtgtctggacagggcccgtattacggacaagctatgtggtttcataaa
tgccctcaagatatccctctcgcgaaggaacgttatgtcaacgagatagcccgggtcatc
agtgtacttgacaaggtcctcgctggaaggaagtaccttgtcgatggcaaactaacttat
gccgatctcgcattcgtaccatggaaccgggttgtcagtcagcatcccttctttaaaaca
tctttgtgggaaaaacacaccattctgaaacaatatcccagcttttcggcttggcaagaa
cgtctcaatgatctcccttctgtaaaggctgcctacaagtaa

DBGET integrated database retrieval system