KEGG   Fusarium pseudograminearum: FPSE_11843Help
Entry
FPSE_11843        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00500  Starch and sucrose metabolism
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FPSE_11843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fpu01003]
    FPSE_11843
Enzymes [BR:fpu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     FPSE_11843
Glycosyltransferases [BR:fpu01003]
 Polysaccharide
  Storage polysaccharide
   FPSE_11843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 20370460
NCBI-ProteinID: XP_009263235
UniProt: K3V4I6
LinkDB All DBs
Position
4
AA seq 704 aa AA seqDB search
MSSGGEQTRDIKNHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQSA
AVEVEEMEPTNPEIAATIQSMRDRGVHIVYGRWLIEGAPRVILIDTKTAYGRMDEWKADL
WEAASIPSPPGDDETNEAIVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVALPLCKRR
RIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHACDV
FTTVSHITAFESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQAKEKIHDFVRGHFYG
HYDFDVDNTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKAAGSKITVVAFIIMPAQTTS
LTVEALKGQAVIKSLRDTTHVIEQSIGRRLFERSLKWHEGEPLPDEKELISAQDRVLLRR
RLFAMKRHGLPPIVTHNMLNDHEDPVLNQIRRVQLFNHPTDRVKVIFHPEFLNSANPVLP
LDYDDFVRGCHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRTKGVDDSVNQLTSFMFDFCGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPNSFVGDEEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREGL
NTEDYVAWKLPEEEDPEEYPFPLTLRKQPAPPSPSETVPVNGTQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgagttccggaggcgagcaaactcgcgacatcaagaaccaccttctctttgagattgct
actgaagtagctcatcgagtcggtggtatctactctgttatcaagtccaaagctcctgtg
acaacagctgaatatggcgaccgctatacgctcattggtcctctcaaccaccaatcggcc
gctgtcgaagtggaagagatggagcccaccaacccagagattgctgctaccatacagtcc
atgagagacagaggagtccacattgtctatggacgctggttgatcgagggagctcccaga
gttattctcatcgacaccaagaccgcctatggccgcatggatgagtggaaggccgatttg
tgggaagccgcgagcatcccctcaccacccggtgatgatgagaccaacgaagccatcgtt
ttcggttatctagttgcatggttcctgggcgagttcgtctgccacgagaagaagaaggct
gttattgctcacttccacgagtggcttgctggcgttgccctgcccctctgcaagaggcgc
cgcatcgatgttacgacgatctttaccacacacgctactcttctcggccgatacctttgc
gccggctccgtggacttttacaacaacttgcagtggttcgatgtcgacgctgaagctggc
aagcgtggtatctaccacagatactgtattgagcgagccgccgcacatgcttgcgatgtt
ttcaccactgtttctcatatcacagctttcgagtctgagcaccttttgaagcgaaagccc
gatggcgttctgcccaatggtctcaacgtcacaaagttctctgctgttcacgagttccag
aacctgcaccagcaggcaaaggaaaagatccacgactttgtccgcggacatttctatggc
cactacgacttcgatgttgataacacactctatcttttcactgctggtcgttacgagttc
aggaataagggcgttgacatgtttatcgagtctctggcacgactgaaccaccgtctcaag
gccgctggcagcaagatcactgttgtggccttcatcatcatgcctgctcagaccacctcg
ctcactgtcgaggcgctcaagggccaggcagtcatcaagtccctgcgcgacaccacacac
gttatcgagcagagtattggacgtcgcctctttgagcgctccctcaagtggcacgagggt
gaacctctccccgatgagaaggagctcatttccgctcaggacagagttctgcttcgtcgt
cgcctctttgccatgaagcgtcacggacttcccccaattgtcacccataacatgctcaac
gatcatgaggaccccgttcttaaccagatccgccgtgtgcagcttttcaaccaccccacc
gatcgcgtcaaggttatcttccaccctgagttcctcaactctgccaaccccgtccttcct
ctcgactacgacgactttgtccgaggttgccatttgggtgtcttctcttcctactatgag
ccttggggttacactcccgcagaatgtaccgtcatgggtgtgcccagcattaccaccaac
ctttccggtttcggatgctacatggaggagcttattgagaactcgagcgactatggtatc
tacattgttgatcgacgaaccaagggtgttgacgattccgtcaaccagctcacttcattc
atgttcgacttctgtggaaagagccgacgtcaacgcatcaaccagcgaaaccgaaccgag
cgtcttagtgatcttctcgactggaagcgaatgggtatggagtatgtaaaggctcgccaa
ctggctcttcgtcgtgcctaccctaactctttcgtcggcgacgaggaggaggaagacttc
atccctggtgtcgagcagaagatttctcgacccttctctgttcccggctcgccacgggat
cgcacaggcatgatgacgcctggagactttgccagtctacaagaaggtcgtgagggcctg
aacaccgaggactatgttgcctggaagcttcctgaggaagaagaccccgaagagtacccc
ttccccctgacacttcgaaagcagcccgcgccacctagcccctcagagaccgtaccggtg
aacggaacccagtag

DBGET integrated database retrieval system