KEGG   Fusarium pseudograminearum: FPSE_12283Help
Entry
FPSE_12283        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00240  Pyrimidine metabolism
fpu00760  Nicotinate and nicotinamide metabolism
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FPSE_12283
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    FPSE_12283
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     FPSE_12283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 20370900
NCBI-ProteinID: XP_009263675
UniProt: K3V703
LinkDB All DBs
Position
1
AA seq 377 aa AA seqDB search
MSEAQVPVWLDCDPGHDDAFAILLAAYHPQMRLLGVSTVFGNASLENTTHNAASILTAIG
MHDIPLYIGLGKALERPALHAPTDIHGVSGLDGTDLLPTPLVTPSTMPAVEAMATALRAQ
QPGTAWIVATGALTNVGALFRAYPEFISHVKGVSLMGGSIGDNFSDAPLGEVDGRPRIGN
YTPWAEFNILVDPEAAATVFHNKEIAAKTTIVPLDLSHQVLATPEVRDMLLYGPGAEKTG
SGKTTLRTMLVELLYFFAQTYADTFGITAGPPLHDPIAVAAILIGTESEIPFFEWDAKHS
QPPQHDERFEVTVITEGTFEEAKEGGKQTGRTIAKLLPPGKQGVRIPRGVDTAKFWQVIE
ECIERADAKNAALALAL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagctcaggttcctgtttggttggattgcgatccaggccatgatgacgctttc
gcaatcctccttgcagcttatcaccctcagatgagactgcttggcgtctcaacagttttt
ggaaacgcatcacttgaaaacaccacacataatgcggcgtctattctcaccgctattgga
atgcatgatatccctttgtacatcggcttgggaaaagcccttgagcgccctgctctccat
gcaccaacagacatccatggcgtttctggactagacggcactgatcttttgcccacgccg
ctcgtcacaccttctaccatgccagccgttgaggccatggccacggctctacgtgcccaa
caacctggaacagcgtggattgttgcgacaggtgcgctgactaatgttggagctctgttc
cgtgcgtacccagaatttatcagccacgtcaagggtgtcagtctcatgggcggctctatc
ggtgacaatttctcagatgcgccgctaggtgaagttgatggccgacctcgaatcggaaac
tacacgccttgggctgagttcaacattctcgttgaccccgaggctgctgcaacagtcttc
cataacaaggagattgctgccaagaccacgattgtgccgcttgatctcagccatcaggtg
ctggccacgcctgaggtgagagatatgcttctgtatggacctggtgccgagaagacaggc
tccggaaagacaactctccgaacaatgctcgttgagctcctttacttctttgcccaaaca
tacgctgacactttcggcattaccgctggccctcctctccatgaccctatagctgttgcc
gccatactgatcggcacggagagcgagatccccttctttgagtgggacgccaagcatagc
cagccccctcagcatgatgagcggttcgaagtcaccgttatcaccgagggcacttttgag
gaggccaaggagggtggtaagcagacaggccgcacaatcgcaaagttactcccgcctggt
aagcaaggtgttagaatcccacgcggagtcgacactgcgaagttctggcaggtcattgaa
gagtgcatcgagcgagcagatgcaaagaatgctgcgcttgcgcttgcactatga

DBGET integrated database retrieval system