KEGG   Flavobacterium psychrophilum V3-5: IA03_05040Help
Entry
IA03_05040        CDS       T03659                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fpv  Flavobacterium psychrophilum V3-5
Pathway
fpv00473  D-Alanine metabolism
fpv01100  Metabolic pathways
fpv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fpv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IA03_05040
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    IA03_05040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fpv01011]
    IA03_05040
Enzymes [BR:fpv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IA03_05040
Peptidoglycan biosynthesis and degradation proteins [BR:fpv01011]
 Precursor biosynthesis
  Racemase
   IA03_05040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AIG29873
UniProt: A0A075S5G8
LinkDB All DBs
Position
1109000..1111444
Genome map
AA seq 814 aa AA seqDB search
MTISLHNIIPILDANFQGIDENIYYDTISIDSRSLQNNENTLFFALVGPNNDAHIYIGDL
ISKGVKNFVVTYIPKRLTGKANFLIVKNTLVALQIFARYYRNLFHFPIIGITGSNGKTIV
KEWLNFLLSPDYNIIRSPKSYNSQVGVPLSVIAINENHNLGIFEAGISTKDEMENLQKII
QPTIGILTNIGTAHDEGFADISEKIKEKLKLFTAVEVLILNKNKTIETFINKEINTFTWS
TNDQSADVFFQKKTLNDHALLNITNQGKYFKIKIPFIDEASLENSMHCILVMLYLKYDLD
TIKHRISQLFPVEMRLKVKNGINNCTLIDDSYSSDFQSLKIALDFLENQKQHLKKTLILS
DIYQSGLENEDLYVRVSQLIISNKINRVICIGGVISKYKNKFLNVISYLSTNDFIEDFDN
LDFTNETILIKGSRHFEFEKIVTLLEEKTHETVLEINLNAISHNLNYFKSKLNPKTKIMV
MVKAFGYGSGSFEIAKLLAHHKVNYLGVAFADEGIELRQAGIQLPIMVLNPEMTSFPSII
QYNLEPEIYSIRGLKAFIKITQQKELTSYPIHIKINTGMNRLGFDAQIIPELISILQKHD
SVLVKSILSHLAASDDLAQDIFTRKQISDFDTISNKITTKLKINPIRHISNTSAISNYPQ
AQFDMVRLGIGLYGVSNDANETKKLENVGTLKSIISQIRNLNSGQSVGYNRRFMVKKPTT
IATIPIGYADGISRAWGNEVGYVLVNEQKAPIVGSICMDMLMIDVTKINCSEGNQVIIFG
KTPSVTTIAKATKTIPYEILTSISSRVKRVFYRE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
ttgactatatccttacacaatataattcctattctagatgccaattttcagggtattgac
gaaaatatttactacgatactatctcgatagatagtcgttcgcttcaaaacaacgaaaac
actttgttttttgcactagttggtcctaataatgatgcccatatttatattggagattta
atctccaaaggtgttaaaaactttgtagttacctatattcctaaaagattaactggcaaa
gcaaattttttaattgtaaaaaacactcttgtagctttacaaatatttgcccgttattat
cgtaatttatttcattttccaatcataggaattacaggaagcaacggaaaaaccattgta
aaagaatggcttaatttcttattaagtcctgattataatataattagaagtcctaaaagc
tacaattcgcaagttggcgttcccctttctgtgattgcaattaatgaaaatcataattta
ggcatttttgaagccggaatttctaccaaagacgaaatggaaaatcttcaaaaaataata
cagccaaccattgggattttaaccaatatagggaccgctcatgatgaaggttttgctgat
atttctgagaaaataaaagaaaaactcaagctatttactgccgtagaagttttaattctt
aataagaataaaaccatcgaaacttttattaacaaagagattaatacttttacttggagt
acaaatgatcagtctgccgatgttttttttcagaaaaaaacactcaatgatcatgctctt
ttgaatattacaaatcaggggaaatattttaaaataaaaattccatttattgatgaagct
tcactagaaaacagcatgcattgcattttggtaatgttatatttgaagtatgatttagat
acaattaagcatcgtatttctcaattatttccagtcgaaatgcgattgaaggtaaaaaac
ggaattaacaattgtactttaattgatgatagttatagttctgattttcagtctttaaaa
atagctttagattttcttgaaaatcaaaaacaacacttaaaaaaaacactcattttatca
gatatttatcagtcaggattagaaaacgaagacttatatgttcgtgtttctcagcttatt
atttcaaacaaaataaatcgagtaatttgcattggaggtgtaatttctaaatataaaaac
aagtttctcaatgtcatttcttacctttcaacaaatgattttattgaagattttgacaat
ctagattttacaaacgaaactattttaataaaaggatctcgacatttcgaattcgaaaaa
attgtaaccttactcgaggaaaaaacacatgaaacagttttagaaattaaccttaatgcc
ataagccataatttaaattacttcaaatcgaaactaaatcccaaaaccaaaatcatggtt
atggtaaaagcttttggttacggaagtggctcatttgagattgccaaactcctcgcccac
cacaaagtaaattatcttggtgtggcattcgccgatgaaggaatcgaactccgccaagca
ggcattcaattacctatcatggttctaaatccagaaatgaccagtttcccatcgataatt
caatacaatttagaacccgaaatatatagtattcgaggtctgaaagcatttataaaaatt
acccaacaaaaagaacttaccagttatcctatacatattaagataaatacaggtatgaat
cgtttgggttttgatgcgcaaattattccagaactcatctcaatattacaaaagcatgat
tcagttttggtaaaaagtattttgtctcatttagcggcaagcgatgatttagcacaggat
atttttacccgaaaacaaatttcagattttgatacaatatctaataaaattaccacaaaa
ttaaaaataaaccctattcgccatatttcaaacacctctgcaataagcaattatccgcaa
gcgcagtttgatatggttcgattaggcattgggttatatggcgtttctaatgatgccaat
gaaacaaaaaaacttgaaaatgtagggacactaaaatcgataatttcacaaattcgcaat
ttaaacagtggccaaagcgtagggtataatagaaggtttatggtaaaaaaacctaccaca
attgctacaatcccaataggctatgccgacggaatttcacgtgcttggggaaatgaagtt
ggttatgttttagttaatgaacaaaaagcccccatagtaggaagtatttgtatggatatg
ctaatgatagatgtcacaaaaattaattgttctgaaggtaatcaagtaattatctttggc
aagaccccatcagtaaccaccatcgcaaaagcaacaaaaacaataccttacgaaatatta
acaagtatttcaagcagggtaaaacgggttttttacagagaataa

DBGET integrated database retrieval system