KEGG   Flavobacterium psychrophilum V3-5: IA03_08420Help
Entry
IA03_08420        CDS       T03659                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fpv  Flavobacterium psychrophilum V3-5
Brite
Enzymes [BR:fpv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     IA03_08420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIG30492
UniProt: A0A075RWG2
LinkDB All DBs
Position
1819557..1820078
Genome map
AA seq 173 aa AA seqDB search
MKNLLLLSCALIFTLIACKSSAGNKNEIKTIFSPKSQSNVAGTANFIEKNGTVTMVANLS
GLTPGEHAIHIHEKSDCSATDGSSAGGHWNPTFKKHGKWGSAEHHKGDIGNFTADLNGNA
TIKFSTSEWCIGCQDPTKDILGKGLIVHKGTDDFTSQPAGNAGARVACSAIIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttacttctactatcatgcgctcttatttttaccctaatagcttgcaaaagt
agcgcaggaaataaaaacgaaataaaaacaatattttctccaaaaagccaaagcaatgta
gctggaactgctaattttattgagaaaaacggaacagtaacaatggttgcaaacctaagc
ggacttacccctggagaacacgccattcacatacacgaaaaatctgattgttctgctacc
gatggaagttctgctggcgggcactggaatccaactttcaaaaaacatggcaaatggggc
tcagcagagcatcataaaggagatattggcaattttactgccgatctaaacggaaatgct
acaataaaattctctacttcagagtggtgtattggctgccaagatccaactaaagatatt
ctaggcaaaggactaatcgttcataaaggaactgacgattttacatcgcaacctgccgga
aatgcaggcgcaagagtagcttgctcagcaattatcaaataa

DBGET integrated database retrieval system