KEGG   Flavobacterium psychrophilum V3-5: IA03_11520Help
Entry
IA03_11520        CDS       T03659                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fpv  Flavobacterium psychrophilum V3-5
Pathway
fpv00010  Glycolysis / Gluconeogenesis
fpv00053  Ascorbate and aldarate metabolism
fpv00071  Fatty acid degradation
fpv00280  Valine, leucine and isoleucine degradation
fpv00310  Lysine degradation
fpv00330  Arginine and proline metabolism
fpv00340  Histidine metabolism
fpv00380  Tryptophan metabolism
fpv00410  beta-Alanine metabolism
fpv00561  Glycerolipid metabolism
fpv01100  Metabolic pathways
fpv01110  Biosynthesis of secondary metabolites
fpv01120  Microbial metabolism in diverse environments
fpv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IA03_11520
   00053 Ascorbate and aldarate metabolism
    IA03_11520
   00620 Pyruvate metabolism
    IA03_11520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IA03_11520
   00561 Glycerolipid metabolism
    IA03_11520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IA03_11520
   00310 Lysine degradation
    IA03_11520
   00330 Arginine and proline metabolism
    IA03_11520
   00340 Histidine metabolism
    IA03_11520
   00380 Tryptophan metabolism
    IA03_11520
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IA03_11520
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    IA03_11520
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    IA03_11520
Enzymes [BR:fpv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     IA03_11520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIG31050
UniProt: A0A076P5I7
LinkDB All DBs
Position
2479606..2481159
Genome map
AA seq 517 aa AA seqDB search
MATIAEQFGMTEALAQLGIKAVNEGTSTGSQWFSNGELLESYSPVDGLLIGKVKATTAAD
YERVMQSATQAFKSFRAMPAPQRGEIVRQFGNKLRELKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQTIPSERPGHVMREQWHSIGVVGIISAFNFPVAVWAWNTAL
AWICGDVCVWKASEKAPLCSVACQNIIADILKANNLPEGISCIINGDYKVGEMMTTDVRI
PLISATGSTRMGRIVGSTVAQRFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTAG
QRCTSTRRLIIHESVYDKVRDAIVGAYGQLTIGNPLDQKNHIGPLIDKESVSTYLAAIEA
AKAEGGKVLVEGGVLQGLGYESGCYVKPAIIEAENTYKIVQHETFAPILYLMKYSGEVEN
AIEVQNGVAQGLSSAIMTNSMKEAEKFLSFSGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTVNYSDELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatagcagaacaattcggcatgaccgaagcattagcacaattaggtataaaa
gcagtaaacgaaggaacttcaacaggaagccaatggttttctaacggagaattactagaa
agctattcaccagtagatggtctattaatagggaaagtaaaagcaactaccgctgccgat
tacgaaagagtaatgcaaagcgcaacccaagcctttaaaagctttagagctatgcctgca
ccacaaagaggggaaattgttcgccaatttggaaataaattaagagaattaaaagaaccc
cttggtaagttagtttcttacgaaatgggtaaatctttgcaagaaggatatggtgaagtt
caagaaatgatagatatctgcgattttgcagtaggtttatctcgacaattaaacggacaa
acaattccttcagaacgtccaggtcatgttatgagagaacaatggcattctattggtgtc
gtaggaattatttctgcctttaattttccagtagctgtttgggcttggaacaccgcttta
gcttggatttgtggagatgtatgcgtttggaaagcttcagaaaaagcgccattgtgttct
gtggcttgccaaaacattattgccgacatattaaaagcaaataatttacccgaaggtatt
tcatgtattattaatggcgattataaagtaggcgaaatgatgactaccgatgtaagaatc
ccattaatttctgcaacaggatctactcgtatgggaagaattgttggttcgacagtagca
caacgttttggtaaatctttactagaattaggaggaaataatgccattattattacacct
actgccgatttgaaagtggttgttccaggagcagtatttggtgctgtgggaactgctgga
caaagatgtacttctacaagaagattaattattcatgaatctgtttacgataaagtaaga
gatgctatcgtgggtgcttatgggcagctaacgattggcaatcctttagatcaaaaaaat
catattggcccgttaatcgataaagaatctgtaagcacttatttagctgccattgaagct
gcaaaagcagaaggcggaaaagtattagttgaaggtggagttttacaaggtcttggttac
gaatctggttgttatgtaaaaccagccattatcgaagccgaaaatacttacaaaattgta
caacacgaaacgtttgctcctattttatatttaatgaaatatagtggtgaagttgaaaat
gcaatcgaagtacaaaacggagttgcccaaggattgtcttcggcaattatgaccaatagt
atgaaagaagcagaaaaattcttatcgttctctggttcagattgcggtattgctaatgta
aacattggaacttctggtgcagaaattgggggtgcttttggtggagaaaaagaaactggt
ggcgggcgtgagtctggctctgatgcttggaaagtttacatgagaagacaaacaaacaca
gttaactattctgacgaattacctttagcacaaggaattaaatttgacttgtag

DBGET integrated database retrieval system