KEGG   Flavobacterium psychrophilum V4-24: IA04_10810Help
Entry
IA04_10810        CDS       T03660                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fpw  Flavobacterium psychrophilum V4-24
Pathway
fpw00380  Tryptophan metabolism
fpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    IA04_10810
Enzymes [BR:fpw01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     IA04_10810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AIG37728
UniProt: A0A076NW97
LinkDB All DBs
Position
complement(2331542..2332819)
Genome map
AA seq 425 aa AA seqDB search
MIFQNTLEFAQQLDNQDELKEYKNEFIFPQHEGKNVIYFTGNSLGLQPKSARNYVDEVMN
DWANLAVEGHFYADKPWWDYQERFANPLSKIVGAKPLEVTVMNTLTVNLHLLMVSFYRPT
KKRYKIICEEKAFPSDQYMFQSQVNFHGYKPEDAIVEIKRREGEHNIRLEDILSKIEAVG
DELALVLFGGVNYYTGQVFDMKTITEAGHKQGAKVGFDLAHAAGNIKLELHDWNVDFAAW
CSYKYMNSGPGNASGCFVHEKHHSDSNLPRFAGWWGHNKERRFKMEPTFDPVHGADGWQI
SNLPILSLAPYLASVEMFAEVGIEKLIRKRNQITAYLEFILHEIDKEVKGHFEILTPTNQ
EERACQLSVFLHGEGRSLFDYLMKNGVVTDWREPNVIRLAPVPLYCSFEDMYNFGQILKK
GILEN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcaaaatacattagaattcgcacagcaattagacaatcaagacgagctaaaa
gaatataaaaacgaatttatctttccgcaacacgagggtaaaaacgttatttattttaca
ggaaattcattaggattacaacctaaatctgccagaaattatgtagatgaagtgatgaac
gattgggcaaacctcgctgtcgaagggcacttttacgcagacaaaccatggtgggattat
caggaacgttttgccaatcctttaagcaaaattgttggtgcaaaaccattggaagtaaca
gtaatgaacacccttacagtaaatcttcacttgcttatggtttccttttatcgtcctaca
aaaaaacgatataagattatttgcgaagaaaaagctttcccgtcagaccaatatatgttt
cagagtcaagtaaactttcatggatataaaccagaagatgcaattgtcgaaataaaaaga
agagaaggcgaacataatatacggctagaagatattttatctaaaatagaagcggtagga
gacgaattagcattagtcttatttggaggcgtaaattattatacaggacaagttttcgat
atgaaaaccattaccgaagcaggacacaaacaaggggctaaagttggtttcgatttggct
catgccgcaggaaacatcaaactagaattgcacgattggaatgtcgattttgcggcttgg
tgttcttataaatatatgaattcagggccaggaaacgcatcaggatgcttcgtgcacgaa
aagcaccatagcgattcaaacttgcctaggtttgcaggttggtgggggcacaacaaagaa
cgacgtttcaagatggaacctactttcgatccagttcatggtgccgatggttggcaaata
agtaatttgccaattctttcattggctccatatttagcatcagtagaaatgtttgcggaa
gttggaatagagaaattaatcagaaaaagaaatcaaattacagcttatttagaatttatt
ctccacgaaatagacaaagaagtaaaaggccatttcgaaattttaacaccaactaatcag
gaagaaagagcttgtcagctctcagtgttcttgcacggagaaggacgttctttattcgat
tatttaatgaaaaacggggttgttacagattggcgtgaacctaatgtaattcgcttagcg
ccagttcctttgtattgctcttttgaagatatgtacaattttggacaaatattaaaaaaa
ggaattttagaaaattaa

DBGET integrated database retrieval system