KEGG   Francisella philomiragia O#319-067: KU46_426Help
Entry
KU46_426          CDS       T03619                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpx  Francisella philomiragia O#319-067
Pathway
fpx00250  Alanine, aspartate and glutamate metabolism
fpx00410  beta-Alanine metabolism
fpx00430  Taurine and hypotaurine metabolism
fpx00650  Butanoate metabolism
fpx01100  Metabolic pathways
fpx01110  Biosynthesis of secondary metabolites
fpx01120  Microbial metabolism in diverse environments
fpx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KU46_426
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KU46_426
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KU46_426
   00430 Taurine and hypotaurine metabolism
    KU46_426
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KU46_426
Enzymes [BR:fpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KU46_426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI48467
LinkDB All DBs
Position
complement(454252..455592)
Genome map
AA seq 446 aa AA seqDB search
MALHAKNDMKHKLYKESLPKFEIPKKSNDAFEAYQQIKDELMLDGNSKQNLATFCQTEVD
DFIHRLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAAML
GGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMTPE
TMLKYCDENTIGVVPTLGVTFTGQYEPVEAVCEALDKFERDTGIDIPVHVDAASGGFLAP
FVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVVWADKKYLPQDLIFNVNYLGGDMPT
FALNFSRPGGQIVAQYYNFVKLGFEGYKNIHKLSYDVAKYIAKEIKDMGIFDIIHAGKGG
IPAVSWSLKAGKSYDLFDISEKIRARGWQIAAYSMPKDRQDLVVMRVLVRRGFSFDLAEL
MIRDLKNVINSLDNKSKDIERGGFSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgttacatgccaaaaatgacatgaaacataagttgtataaagaatcattaccaaaa
tttgaaattcccaaaaaatcaaatgatgctttcgaagcatatcaacaaatcaaagatgag
ctaatgctcgatggtaattcaaagcagaatttagcgacattttgtcaaacagaagttgat
gatttcattcataggcttatggatgattgcattgataagaatatgattgataaagatgag
tatcctcaaactgctgaaatagagtcacgatgtgtcaacatactagcaaacctatggaac
tcttcagcagaaaatgcaatcggctgttcaactactggctcatctgaagcagctatgctt
ggcggtatggcaatgaagtggcgctggcgtgataagatgaaagcacaaggtaaagattat
acaaaacctaatcttgttacaggacctgtgcaagtctgctggcataaattcgctagatat
tgggatattgagcttagagagattccaatgtcaaatgaaagtttaataatgactccagaa
actatgcttaagtactgtgatgaaaatacaattggagttgtgccgactttaggggttacc
tttacaggtcagtacgagcctgttgaggcagtttgtgaagcacttgataaatttgagaga
gatactggtattgatattccagtgcatgtagatgctgcttctggaggatttttggcacca
tttgtagagcctgaacttaagtgggattttagattaccaagagttaagtcaattaattca
tcaggacataagtttgggttatcgccattaggagtgggttgggttgtttgggcagataag
aaatacttacctcaagatttgatttttaatgttaattatcttggtggtgatatgccgaca
tttgctttgaatttctctcgacctggtggtcagatagttgcccagtattataactttgtt
aagcttggttttgaaggatataaaaatattcataagcttagttatgatgttgcaaaatat
attgctaaagaaattaaggatatgggtatctttgatattattcatgctggtaaaggtggt
atcccagcagtgagttggtcacttaaggcaggcaaaagttatgatttgtttgatatctct
gaaaaaattcgtgctagaggttggcagatagctgcttattcgatgccaaaagatagacaa
gacttggtagttatgcgagtgcttgttaggagaggctttagctttgatttagcggagctt
atgattagggatctaaaaaatgttattaattctttagataataaatctaaagatatcgaa
agaggtggtttttcgcattag

DBGET integrated database retrieval system