KEGG   Flavobacterium psychrophilum FPG101: FPG101_07225Help
Entry
FPG101_07225      CDS       T03281                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fpy  Flavobacterium psychrophilum FPG101
Pathway
fpy00240  Pyrimidine metabolism
fpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FPG101_07225
Enzymes [BR:fpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FPG101_07225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AIN71711
LinkDB All DBs
Position
1570029..1570637
Genome map
AA seq 202 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPTIDTRYDDEM
VVSHNKNEIRSTPVPAAANIAILAQGCDVVGIDEAQFFDDEIVKICNDLANSGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKTDNDKLVMLGETEEYEP
LSRAAYYNAMRENMIVKDAEHL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcagtttggttggattgaagttatttgc
ggatcgatgttttcgggtaaaaccgaggagttaattcgtagattaaaaagagcacaattt
gccaaacaaaaagtcgaaatttttaaacccactatcgataccagatatgatgacgaaatg
gtggtttcgcataacaaaaacgagattagatctacgcctgttcccgcagctgcaaacatt
gcaattttagcccaaggttgcgatgttgttgggattgatgaggcgcaattttttgatgac
gagattgtaaaaatttgtaatgaccttgccaattcaggcattagagttattgtggctgga
ttggatatggattttaaaggaaatccttttggccccatgccagcacttatggcaacggca
gaatatgttacaaaagtacacgccgtttgtacccgtacaggaaatttggccaattatagt
tttcgcaaaaccgataatgacaaactcgttatgcttggcgaaaccgaagaatacgaaccc
ttaagtcgtgccgcatattataatgccatgagagaaaatatgattgtaaaagatgctgaa
catttataa

DBGET integrated database retrieval system