KEGG   Frankia casuarinae: Francci3_0938Help
Entry
Francci3_0938     CDS       T00320                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fra  Frankia casuarinae
Pathway
fra00564  Glycerophospholipid metabolism
fra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Francci3_0938
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Francci3_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 3HCDH_N Pyr_redox GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABD10322
RhizoBase: Francci3_0938
UniProt: Q2JEH0
LinkDB All DBs
Position
complement(1102552..1104339)
Genome map
AA seq 595 aa AA seqDB search
MTPTRHGTPTARLDQVGRAEALRRMGADPVDVAVIGGGVTGTGVALDAVTRGLSVALVEA
RDLAAGTSSRSSKLIHGGLRYLEQLNAPLVREALRERSLMLDTLAPHLVRAIPFLLPLTR
HGWERAYIGSGVLLYDTLGQGLARVGPGGDATMPHHRHLTRKAALREFPSLRPDALVGAI
QYWDGQVDDARHTVFVARTAARYGALIATSARVTGFLREGDRVAGVRVRDLESGAEIELR
ARQTINAAGVWTDEIQAMVGGRGQLSVRASKGVHIVVPRDRIHGVTGLILRTEKSVLFVI
PWGSHWIIGTTDTDWSLDLAHPAASSADIDYLLDTVNRVLRTPLTAADITGVYAGLRPLL
AGESEDTSRLSREHAVVSPVSGLTMVAGGKYTTYRVMAADAVDAAVHGMNRAVPPSCTEK
IPLLGADGFPALWNARETLARRAGLHVGWIEHLLHRYGTLTEELLDLIETRPDLAQPLRG
ASTYLAAEAVYAASHEGALHLEDVLTRRTRVSIETIDRGVEAAEHVADLIAPVLGWDQVT
RAREVAHYLARVEAERASQRQADDATADAARLGAPDVRRLGRTDHRAPAATGGPS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaccagacacggaaccccgaccgcccgactcgaccaggtcggccgcgccgag
gcactgcgccggatgggagcggatccggtggatgtggccgtgatcggcggcggggtcacc
ggtacgggggtggcgctggacgcggtgacccggggcctgtccgtcgccctggtcgaggcg
cgcgacctcgccgccggcacgtccagccggtcgagcaagctcatccacggcgggctgcgg
tatctcgagcagctcaacgccccgctggtccgggaggcgctgcgggagcggtccctcatg
ctggacacgctcgcgccccatctggtccgggccatcccgttcctgctgccgttgacccgc
cacggttgggaacgtgcctacatcggcagtggtgtgctgctctacgacaccctcgggcag
gggctggcccgcgtcgggccgggcggcgacgccaccatgccccatcaccggcacctgacc
cgcaaggcggcgctgcgggagttcccgtcgctgcgcccggacgccctcgtcggcgcgatc
cagtactgggacggccaggtcgacgacgcgcggcacaccgtgttcgtcgcgcggaccgct
gctcgctacggggcgctcatcgcgaccagcgcgcgggtcaccggcttcctgcgggagggc
gaccgggtcgccggcgtgcgggtgcgtgacctcgagtcgggcgccgagatcgagctgcgg
gcccgccagacgatcaacgccgccggggtgtggaccgacgagatccaggcgatggtaggc
gggcgtggccagctgtcggtccgagcctccaagggagtgcacatcgtcgtgccccgcgac
cgcatccatggcgtcaccggcctgatcctgcgcaccgagaagagcgtgctgttcgtcatc
ccgtggggcagccactggatcatcggcaccaccgacaccgactggagcctcgacctcgcc
catccggcggccagcagcgccgacatcgactacctgctcgacacggtcaaccgggtgctg
cgcacgccgctcacggcggcggacatcaccggggtgtacgccgggctgcgcccgctgctc
gccggggagtccgaggacacctcgcggctgtcccgcgagcatgccgtggtcagccccgtc
tccgggctgacgatggtcgccggcgggaagtacacgacctaccgggtgatggccgccgac
gccgtcgacgcggccgtgcacggcatgaaccgggcggtgccgccgtcgtgcaccgagaag
atcccgctgctcggcgcggacgggttccccgcgctgtggaacgcccgggagaccctcgcc
cgccgcgcggggctgcacgtcggctggatcgagcacctcctgcaccgctacggcaccctc
accgaggagcttctggacctcatcgagacgcgaccggatctcgcccagccgctgcgcggg
gcatcgacctacctggccgcggaggcggtgtacgcggcctcccacgagggggcgctgcac
ctggaggacgtgctcacccggcggacccgcgtctcgatcgagaccatcgaccggggggtg
gaggccgccgagcacgtggccgatctcatcgcccccgtgctcggctgggaccaggtgacc
cgcgcccgcgaggtcgcgcactacctcgcccgggtggaggccgaacgggcctcgcagcgg
caagccgacgacgcgaccgccgacgcggcccggctcggcgcgcccgacgtgcgccggctg
ggccggacggaccaccgcgccccggcggcgaccggcggaccgtcctga

DBGET integrated database retrieval system