KEGG   Frankia sp. CcI3: Francci3_1678Help
Entry
Francci3_1678     CDS       T00320                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
fra  Frankia sp. CcI3
Pathway
fra00010  Glycolysis / Gluconeogenesis
fra00230  Purine metabolism
fra00620  Pyruvate metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
fra01230  Biosynthesis of amino acids
Module
fra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fra_M00002  Glycolysis, core module involving three-carbon compounds
fra_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
fra_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_1678
   00620 Pyruvate metabolism
    Francci3_1678
  Nucleotide metabolism
   00230 Purine metabolism
    Francci3_1678
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Francci3_1678
Membrane trafficking [BR:fra04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Francci3_1678
Exosome [BR:fra04147]
 Exosomal proteins
  Proteins found in most exosomes
   Francci3_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-ProteinID: ABD11054
RhizoBase: Francci3_1678
UniProt: Q2JCD8
LinkDB All DBs
Position
2013257..2014672
Genome map
AA seq 471 aa AA seqDB search
MPRRAKIVCTLGPATSSPEKVRALVDAGMDIARLNFSHGTHEQHAVTYARVREAAEAAGR
SVGTLADLQGPKIRLGNFADGGVTLLPGQRFTVTIRDVPGDQHQVGTTYPGLPGDVAAGD
RVLVDDGRLVLQIDGVTDTDVHTTVVVGGPVSDHKGMNIPNAALTVPALTEKDAADLRFA
LNLGVDMVALSFVRSAVDAAAVHAIMDEVGIRVPVHAKIEKPQAVAELDEIIEAFDGLMI
ARGDLGVELPLEDVPLVQKRAVSQARERAKPVIVATQVLESMVSAPRPTRAEASDCANAV
LDGADAIMLSAETSVGAYPIEATATMARIIETAEADLGRIPPLRTEPRTLGGALAQAAAS
VGAAVGARYLVAHTLSGDTARRLARYRTEVPVLAFTPIPAVRNQMALFWGVETFLVPFAD
STDEMVRQVDSALFHIGRCKPGELVVVVAGTPPGVAGMTNMMRVHRIGEAI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgtagagccaagattgtttgtaccctcggccccgcgaccagctcgccagagaag
gtccgggccctcgtcgacgcgggaatggacattgcccgactaaacttctcccacggaaca
cacgaacagcatgccgtcacttacgcgcgggtgcgcgaggccgcggaggcggccggccgc
agcgtcggcacgctcgccgacctccagggaccgaaaatccggctggggaacttcgccgac
ggcggggtcaccctgctgcccggtcagcggttcaccgtcacgatccgcgatgttcccggc
gatcagcatcaggtcggcacgacctacccgggcctgccgggcgacgtcgcggccggggat
cgcgtcctggtcgacgacggccgcctggtcctgcagatcgacggggtgactgacaccgac
gtccacaccacggtcgttgtcggcgggccggtgagcgaccacaaggggatgaacattccc
aacgccgcgctcaccgtcccggcgctcaccgagaaggacgccgctgacctgcggttcgct
ctcaacctcggggtggacatggtcgcactgtccttcgtccggagcgccgtggacgccgcg
gcggtgcatgcgatcatggatgaggtggggatccgggttccggtccacgccaagatcgag
aagccgcaggcggtcgccgaactcgacgagatcatcgaggcgttcgacggtctgatgatc
gcccgtggcgatctcggggtcgagctgccgctcgaggacgtgccgctcgtgcagaagcgc
gccgtcagccaggcccgggagcgggccaagccggtgatcgtcgcgacccaggtgctcgag
tccatggtcagcgcgccgcggccgacccgtgccgaggccagtgactgcgccaacgccgtc
ctggacggcgctgacgcgatcatgctgtcggcggagacgagcgtcggtgcctaccccatc
gaggccacggccaccatggcgcgcatcatcgagaccgccgaggccgacctcggccggata
ccgcccctgcggaccgaaccgcgcacgctcggtggggcactcgcccaggccgccgcgtcg
gtaggagccgcggtcggcgcccgttacctcgtggcccacaccctcagtggtgacacggcc
cggcgactcgcccggtaccgtaccgaggtcccggtgctggccttcacgccgattccggct
gtccgcaaccagatggcgctcttctggggcgtggaaaccttcctcgtgccgttcgcggac
agcacggacgagatggtccgccaggtcgacagcgccctcttccatattggccgatgcaag
ccgggtgaactggtggtcgtcgtcgccgggacgccgccgggcgtggccggcatgaccaac
atgatgcgggtccatcgcatcggggaggccatctga

DBGET integrated database retrieval system