KEGG   Frankia sp. CcI3: Francci3_2945Help
Entry
Francci3_2945     CDS       T00320                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fra  Frankia sp. CcI3
Pathway
fra00010  Glycolysis / Gluconeogenesis
fra00071  Fatty acid degradation
fra00350  Tyrosine metabolism
fra00625  Chloroalkane and chloroalkene degradation
fra00626  Naphthalene degradation
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_2945
  Lipid metabolism
   00071 Fatty acid degradation
    Francci3_2945
  Amino acid metabolism
   00350 Tyrosine metabolism
    Francci3_2945
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Francci3_2945
   00626 Naphthalene degradation
    Francci3_2945
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Francci3_2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABD12303
RhizoBase: Francci3_2945
UniProt: Q2J8T9
LinkDB All DBs
Position
3479285..3480295
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTDFRAPLRIEDRDVPVPGPGQILVRMEASGLCHTDIHAAHGDWPVKPTPPFVPG
HEGVGVVKAVGAGVTGRAIGDRVAIPWLGHACGRCRYCVGGWETLCESQRNSGYSIDGAF
AEYAVADADYTVPVPGDVPSFDAAPLTCAGVTTYKAIKVAGVTPAETVAVFGIGGLGHLA
LQYARIAGGFTVGVDVTEAKLELATELGADHVVNARTADPVEAIQRLGGADVAVALAASP
RSFEQAFASLRRGGRLVCVALPADGTMSIPIFDTVLKGITVKGSIVGTRNDLAEVFRLHA
AGRTRVIASGRKLDDVNACMDEVLDSRVPARLVFEF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagttgtcaccgatttccgggcaccgttgcgtatcgaggaccgggacgtc
ccggtgccggggccgggccagatcctggtacggatggaggccagcggtctgtgccacacc
gacatccacgcggcgcacggtgactggccggtgaagccgactcccccgttcgtccctggt
cacgagggcgtcggcgtggtcaaggccgtgggcgccggggtgaccgggcgcgcgatcggc
gaccgggtcgcgatcccgtggctcggtcacgcctgcggacgctgccgctactgcgtcggc
ggctgggagacgctgtgcgaaagccagcgcaacagcggctactcgatcgacggtgcgttc
gccgagtacgcggtggccgacgcggactacacggtgccggtgcccggtgacgtgccgtcg
ttcgacgccgcgccgctgacctgcgccggcgtgaccacctacaaggccatcaaggtagcc
ggggtgaccccggccgagacggtggccgtgttcggcatcggcgggctgggccacctggcg
ttgcagtacgcccgcatcgcgggtggtttcaccgtcggggtcgacgtcaccgaggccaag
ctggagctggccaccgaactgggcgccgaccacgtggtgaacgcgcggaccgccgacccg
gtcgaggccatccagcggctgggcggcgccgacgtggcggtcgcgctcgccgcgtcgccc
cgttcgttcgagcaggcgttcgcctcgctgcggcgcggcggccggctggtctgcgtggcc
ctgccggcggatggcacgatgtccatcccgatcttcgacacggtcctgaaggggatcacg
gtcaagggatcgatcgtcggcacccgcaacgatctggccgaggtgttccggctgcacgcg
gccggccggaccagggtgatcgcttccggccggaagttggacgacgtcaacgcctgcatg
gacgaggtcctggacagcagggtcccggcccggctggtgttcgagttctga

DBGET integrated database retrieval system