KEGG   Frankia casuarinae: Francci3_2949Help
Entry
Francci3_2949     CDS       T00320                                 

Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
fra  Frankia casuarinae
Pathway
fra00380  Tryptophan metabolism
fra00630  Glyoxylate and dicarboxylate metabolism
fra01110  Biosynthesis of secondary metabolites
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Francci3_2949
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Francci3_2949
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Francci3_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABD12307
RhizoBase: Francci3_2949
UniProt: Q2J8T5
LinkDB All DBs
Position
complement(3483997..3486126)
Genome map
AA seq 709 aa AA seqDB search
MTDPGTSRLPRDDAKQQQLDAVRIGDDGARMTTDQGIGVEHTDDSLAAGERGPTLLEDFH
FREKLTRFDHERIPERVVHARGAGAYGYFEAYESLADVTRAHFLGEDGRRTPVFVRFSTV
GGSRGSADTVRDVRGFAVKFYTEEGNFDLVGNNMPVFFIQDGIKFPDFVHAVKPEPHNEI
PQASSAHNTLWDFVSLVPESMHMMMWLMSDRALPRSYRMMQGFGVHTFRFVDAAGQGTFV
KFHWRPKLGTHSLVWDETQKIAGKDPDFNRRDLWESIENGTFPEWELGVQLVPESDEHAF
DFDLLDATKIIPEERVPVRPVGRLVLNRNPGNFFAETEQVAFCVQNVVPGIDFTNDPLLQ
ARLFSYLDTQLIRLGGPNFAQLPVNRPVAAVHNNSRDGYGQHRIQQSQTSYFPNSISGGC
PVLSDPAHGGYVHYAERVDGNTIRKRSESFKDFYSQATLFWNSMSSWERRHIVDAFSFEL
GKVDYTQIKERVLGHLAQVDHELAAGVAENLGLPVPPESTPNHGRSSPALSQADQPSGVA
TRRIAVLAADGVDEVALRSATAALREQGAILEVLAPHGGMLATVSGDALPVDRTLVTMSS
VLYDAVFVAPGERGVTALTHNGEAVHYVGEAYKHAKPIGAVGAGVSLLEIASLPGARVAD
QGDAVVSDRGIVTVRDLAGPSVLGDFGSAFATAVAAHRHFDRALEAVAA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcccgggacgtcgcgcctcccccgggacgacgcgaagcagcagcaactcgac
gccgtccgaatcggcgacgacggcgcccgcatgaccaccgaccaggggatcggtgtcgaa
cacaccgacgactcgctcgcggcgggggaacgcggtccgacgctgctggaggacttccac
ttccgggagaagctcactcggttcgatcacgagcgcatccccgagcgggtcgtccacgcc
cgtggtgccggtgcctacgggtacttcgaggcgtacgagtcgctcgccgacgtgacccgg
gcgcacttcctgggcgaggacggccggcgtaccccggtgttcgtacggttctcgaccgtc
ggcggttcccgcggttccgcggacacggtccgggacgtacgcggatttgccgtaaaattt
tataccgaggagggtaacttcgatctcgtcggtaacaacatgccggtgttcttcattcag
gacggcatcaagttccccgacttcgtccatgcggtgaagccggagccgcacaacgagatc
ccgcaggcatcctccgcgcacaacaccctgtgggacttcgtcagtctcgtccccgagtcg
atgcacatgatgatgtggctgatgtcggaccgggcgctgccgcgcagctaccggatgatg
cagggcttcggcgtgcacaccttccggttcgtcgatgccgccgggcaggggaccttcgtc
aagttccactggcggccgaagctcggcacgcactccctggtctgggacgagacacagaag
atcgcgggcaaggaccccgacttcaaccggcgggacctgtgggagtcgatcgagaacggt
acgttcccggagtgggaactcggcgtgcagctcgtgccggaatccgacgagcacgcgttc
gacttcgatcttctcgacgcgacgaagatcatccctgaggagcgggtgccggtgcggccg
gtgggacggctggtgctcaaccgcaaccccggcaatttcttcgccgagaccgagcaggtg
gcgttctgcgtacagaacgtcgtccccggcatcgacttcacgaacgacccgctgctgcag
gcccggctgttctcctacctggacacccagctgatccggctcggcggcccgaacttcgcc
cagctgccggtcaaccggccggtcgcggcggtgcacaacaactcccgcgacggttacggg
cagcatcgcatccagcagagccagacgtcgtacttcccgaactcgatcagcggcggttgc
ccggtgctctccgatccggcgcacggcgggtacgtgcactacgccgagcgggtcgacggg
aacacgatccgtaagcggagcgagagcttcaaggacttctacagccaggccaccctgttc
tggaacagcatgtcctcctgggagcggcggcacatcgtcgacgcgttcagctttgagctc
ggcaaggtcgactacacccagatcaaggagcgtgtcctgggacatctcgcccaggtggac
cacgaactcgcggccggggtcgccgagaacctcggactgccggtgccaccggagagcacc
ccgaaccacggacgatcctcacccgcgctgagtcaggccgaccagcccagcggggtggcc
acccgcaggatcgcggtgctcgcggcggacggcgtggacgaggtggcattgcgttcggcc
accgccgcgctgcgcgaacagggcgcgatcctggaggttctcgcgccgcacggaggcatg
ctcgccacggtgtccggcgacgcgttgccggtggaccgaacgctggtgaccatgtcctcg
gtcctctacgacgcggtgttcgtcgccccgggcgagcgcggtgtcaccgcactgacacac
aacggcgaggccgtgcactacgtcggcgaggcgtacaagcacgcgaagccgatcggcgcg
gtcggcgcgggggtgtcgctgctcgagatcgcatccttgccgggcgcgcgggtcgccgac
cagggtgacgcggtggtgtccgaccggggtatcgtgacggtccgcgaccttgcggggccg
tccgtgctcggcgacttcggttccgcgttcgccacggccgtggccgcccatcggcacttc
gaccgcgcgctggaggccgtcgccgcgtag

DBGET integrated database retrieval system