KEGG   Frankia casuarinae: Francci3_4205
Entry
Francci3_4205     CDS       T00320                                 

Definition
(GenBank) 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
fra  Frankia casuarinae
Pathway
fra00997  Biosynthesis of various secondary metabolites - part 3
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Francci3_4205
Enzymes [BR:fra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     Francci3_4205
SSDB
Motif
Pfam: DeoC ThiG NMO
Other DBs
NCBI-ProteinID: ABD13553
RhizoBase: Francci3_4205
UniProt: Q2J589
LinkDB
Position
5021229..5022065
AA seq 278 aa
MTEQHFARALRMARLHRWHPARLAITPLDHSISDGPVVPRGTTIDGLAGQLVEAGVDAIV
VHKGSLRHLRPARLTGMSVIVHLNASTAHAPDPDAKYLVTGVEEALRLGADAVSLHVNLG
SLDERQQIGDLGRVAERCEQWNLPLLAMMYPRGPRISDPHDPELIAHAVTLAVDLGADLV
KAPFPGSVPALRDLTDACPVPLLCAGGPRRSEDDVLAYVRDVLHGGAAGVAMGRSIFQAD
DPRRMAAAVAQLVHAESEPRLEPTAEGQRSERKEAVLA
NT seq 837 nt   +upstreamnt  +downstreamnt
gtgacagaacagcacttcgcccgtgcgctgaggatggcccggctccaccgctggcacccc
gccaggctggcgatcacaccgctcgaccactcgatcagcgacggacccgtggtgccgcgc
ggcaccaccatcgacggcctcgcaggtcagctggtggaggccggcgtggacgccatcgtc
gtccacaagggcagcctccggcaccttcgtcccgcccgtctcaccggcatgtcggtgatc
gtccatctcaacgcaagcaccgctcacgcacccgatccggatgccaagtacctggtcacc
ggagtggaggaagcgctcaggctgggtgcggacgcagtcagtctgcacgtcaacctcggc
tccctcgacgaacgccagcagatcggggacctcggccgggtcgcggagcgctgcgagcag
tggaacctgccgctgctcgcgatgatgtacccgcgcgggccgcggatcagcgacccgcat
gatccggagctgatcgcgcacgcggtcacactcgccgtggacctgggcgcggacctggtc
aaggcccccttccccgggtccgtcccggccctgcgcgacctgacggacgcctgccccgtc
cccctgctgtgcgccggcggaccccgccgcagtgaggacgacgttctggcgtacgtacgc
gacgtgctgcacggcggggccgccggcgtggccatgggccgcagcatcttccaggccgac
gacccgcggcggatggctgcggcggtggcccaactggtccatgcggaatccgagcctcgt
ctcgaaccgactgcagaagggcagcgaagtgaacgcaaggaagctgtgctggcttga

DBGET integrated database retrieval system